GLE1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GLE1 Antibody [NBP2-56561] - Staining of human cell line MCF7 shows localization to nucleoli & nuclear membrane.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLE1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NEDLQVKVQDITMQWYQQLQDASMQCVLTFEGLTNSKDSQAKKIKMDLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQ
Specificity
Specificity of human GLE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLE1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLE1 Recombinant Protein Antigen (NBP2-56561PEP)

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GLE1 Antibody

  • GLE1 (yeast homolog)-like, RNA export mediator
  • GLE1 RNA export mediator homolog (yeast)
  • GLE1LGLE1 RNA export mediator-like (yeast)
  • GLE1-like protein
  • GLE1-like, RNA export mediator
  • hGLE1GLE1 RNA export mediator (yeast)
  • LCCS
  • LCCS1
  • lethal congenital contracture syndrome 1
  • nucleoporin GLE1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-760
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Ha, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP1-88706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86712
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2244
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-82986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87826
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF, KD
H00010928-M02
Species: Hu, Xp
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP3-05510
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56561
Species: Hu, Mu
Applications: ICC/IF

Publications for GLE1 Antibody (NBP2-56561) (0)

There are no publications for GLE1 Antibody (NBP2-56561).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLE1 Antibody (NBP2-56561) (0)

There are no reviews for GLE1 Antibody (NBP2-56561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GLE1 Antibody (NBP2-56561) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GLE1 Products

Bioinformatics Tool for GLE1 Antibody (NBP2-56561)

Discover related pathways, diseases and genes to GLE1 Antibody (NBP2-56561). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLE1 Antibody (NBP2-56561)

Discover more about diseases related to GLE1 Antibody (NBP2-56561).
 

Pathways for GLE1 Antibody (NBP2-56561)

View related products by pathway.

PTMs for GLE1 Antibody (NBP2-56561)

Learn more about PTMs related to GLE1 Antibody (NBP2-56561).

Blogs on GLE1

There are no specific blogs for GLE1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLE1