GLE1 Antibody - BSA Free

Western Blot: GLE1 Antibody [NBP2-47449] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.

Immunohistochemistry-Paraffin: GLE1 Antibody [NBP2-47449] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GLE1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GLE1 Antibody - BSA Free (NBP2-47449) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RCWETLKALRSSDKGRLCYYRDWLLRREDVLEECMSLPKLSSYSGWVVEHVLPHMQENQPLSETSPSSTSASALDQPSFVPKSPDAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GLE1 Protein (NBP2-47449PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GLE1 Antibody - BSA Free

• GLE1 (yeast homolog)-like, RNA export mediator
• GLE1 RNA export mediator homolog (yeast)
• GLE1LGLE1 RNA export mediator-like (yeast)
• GLE1-like protein
• GLE1-like, RNA export mediator
• hGLE1GLE1 RNA export mediator (yeast)
• LCCS
• LCCS1
• lethal congenital contracture syndrome 1
• nucleoporin GLE1

Background

GLE1 encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunofluorescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLE1