GLCCl1 Antibody

Images

 
Immunohistochemistry: GLCCl1 Antibody [NBP1-87938] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLCCl1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSSPERRSPGSPVCRADKAKSQQVRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADQLKEQIAKLRQQLQRSKQSSRHSKEKDR
Specificity
Specificity of human GLCCl1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLCCI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLCCl1 Antibody

  • FAM117C
  • GCTR
  • GIG18
  • glucocorticoid induced transcript 1
  • glucocorticoid-induced transcript 1 protein
  • TSSN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP2-38988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85614
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47492
Species: Hu, Bb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
AF1438
Species: Hu
Applications: WB, IHC
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-76932
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC
AF4256
Species: Hu
Applications: WB
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc

Publications for GLCCl1 Antibody (NBP1-87938) (0)

There are no publications for GLCCl1 Antibody (NBP1-87938).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLCCl1 Antibody (NBP1-87938) (0)

There are no reviews for GLCCl1 Antibody (NBP1-87938). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GLCCl1 Antibody (NBP1-87938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLCCl1 Products

Bioinformatics Tool for GLCCl1 Antibody (NBP1-87938)

Discover related pathways, diseases and genes to GLCCl1 Antibody (NBP1-87938). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLCCl1 Antibody (NBP1-87938)

Discover more about diseases related to GLCCl1 Antibody (NBP1-87938).
 

Pathways for GLCCl1 Antibody (NBP1-87938)

View related products by pathway.

PTMs for GLCCl1 Antibody (NBP1-87938)

Learn more about PTMs related to GLCCl1 Antibody (NBP1-87938).
 

Research Areas for GLCCl1 Antibody (NBP1-87938)

Find related products by research area.

Blogs on GLCCl1

There are no specific blogs for GLCCl1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLCCl1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLCCI1
Uniprot