GLCCl1 Antibody

Images

 
Western Blot: aspartate aminotransferase Antibody [NBP1-70414] - This Anti-GLCCI1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLCCl1 Antibody Summary

Immunogen
Synthetic peptides corresponding to GLCCI1 (glucocorticoid induced transcript 1) The peptide sequence was selected from the middle region of GLCCI1. Peptide sequence PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSAD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLCCI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GLCCI1 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GLCCl1 Antibody

  • FAM117C
  • GCTR
  • GIG18
  • glucocorticoid induced transcript 1
  • glucocorticoid-induced transcript 1 protein
  • TSSN1

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NBP1-93947
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
H00005071-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4256
Species: Hu
Applications: WB
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-70414
Species: Hu
Applications: WB

Publications for GLCCl1 Antibody (NBP1-70414) (0)

There are no publications for GLCCl1 Antibody (NBP1-70414).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLCCl1 Antibody (NBP1-70414) (0)

There are no reviews for GLCCl1 Antibody (NBP1-70414). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLCCl1 Antibody (NBP1-70414) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLCCl1 Products

Bioinformatics Tool for GLCCl1 Antibody (NBP1-70414)

Discover related pathways, diseases and genes to GLCCl1 Antibody (NBP1-70414). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLCCl1 Antibody (NBP1-70414)

Discover more about diseases related to GLCCl1 Antibody (NBP1-70414).
 

Pathways for GLCCl1 Antibody (NBP1-70414)

View related products by pathway.

PTMs for GLCCl1 Antibody (NBP1-70414)

Learn more about PTMs related to GLCCl1 Antibody (NBP1-70414).

Blogs on GLCCl1

There are no specific blogs for GLCCl1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLCCl1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLCCI1
Uniprot