GIRK2 Antibody - BSA Free

Western Blot: GIRK2 Antibody [NBP3-03526] - Western blot analysis of extracts of various cell lines, using GIRK2 antibody (NBP3-03526) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GIRK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GIRK2 Antibody - BSA Free (NBP3-03526) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human GIRK2 (NP_002231.1). MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNVRETYRYLTDI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNJ6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 48 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GIRK2 Antibody - BSA Free

• BIR1
• BIR1Kir3.2
• G protein-activated inward rectifier potassium channel 2
• GIRK2
• GIRK-2
• GIRK2KATP-2
• hiGIRK2
• Inward rectifier K(+) channel Kir3.2
• inward rectifier potassium channel KIR3.2
• KATP2
• KATP-2
• KATP2human G protein coupled inward rectifier potassium channel 2 (hiGIRK2)10KCNJ7KIR3.2
• KCNJ6
• KCNJ7
• MGC126596
• Potassium channel, inwardly rectifying subfamily J member 6
• potassium inwardly-rectifying channel, subfamily J, member 6

Background

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins and may be involved in the regulation of insulin secretion by glucose. It associates with two other G-protein-activated potassium channels to form a heteromultimeric pore-forming complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNJ6