GHRH Antibody (8G5Y9) Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GHRH (NP_066567.1).
Sequence: MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQ |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
GHRH |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA Recommended starting concentration is 1 ug/mL
- Western Blot 1:500 - 1:1000
|
Theoretical MW |
12 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for GHRH Antibody (8G5Y9)
Background
GHRH, also known as Somatoliberin or Growth hormone-releasing hormone, has a 108 amino acid isoform and a 107 amino acid isoform that are 12 kDa, is produced by the hypothalamus and its main function is to stimulate growth hormone release. Disease research is being performed on this proteins involvement in gigantism, isolated growth hormone deficiency due to defect in ghrf, dwarfism, gigantism due to ghrf hypersecretion, zollinger-ellison syndrome, anorexia, nervosa, multiple endocrine neoplasia, polycystic ovary syndrome, short stature, Cushing's syndrome, hypopituitarism, diabetes insipidus, panic disorder, hypothyroidism, somatostatinoma, acromegaly, vipoma, pituitary adenoma, Prader-Willi syndrome, hyperprolactinemia, cancer, lipodystrophy, hypogonadism, diabetes mellitus, and Pseudohypoparathyroidism. This protein has been involved in 55 different pathways such as nuclear receptor activation by vitamin-A, Paxillin Interactions, telomerase components in cell signaling, mitochondrial apoptosis, molecular mechanisms of cancer, antioxidant action of vitamin-C, eIF2 pathway, intracellular calcium signaling, JNK pathway, apoptotic pathways in synovial fibroblasts, ERK5 signaling, Tec kinases signaling, GSK3 signaling, and cellular apoptosis pathway where it interacts with GHRHR, DPP4, FAP, ADCYAP1R1, POMC, NPS, MC4R, ADRB1, and 50 other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: EnzAct
Publications for GHRH Antibody (NBP3-33413) (0)
There are no publications for GHRH Antibody (NBP3-33413).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GHRH Antibody (NBP3-33413) (0)
There are no reviews for GHRH Antibody (NBP3-33413).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GHRH Antibody (NBP3-33413) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GHRH Products
Research Areas for GHRH Antibody (NBP3-33413)
Find related products by research area.
|
Blogs on GHRH