GFR alpha-1/GDNF R alpha-1 Antibody (4G3) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
GFRA1 (NP_005255, 32 a.a. ~ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS |
Specificity |
GFRA1 (4G3) |
Isotype |
IgG2b Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
GFRA1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
|
Application Notes |
Antibody reactivity against recombinant protein on ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GFR alpha-1/GDNF R alpha-1 Antibody (4G3)
Background
Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Two alternatively spliced transcipt variants encoding different isoforms have been described for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Bind, BA
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: Bind, BA
Species: Hu, Mu
Applications: Block, ICC, IHC, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: BA, PAGE
Species: Hu
Applications: Neut, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Rt
Applications: IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF
Publications for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M08) (0)
There are no publications for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M08).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M08) (0)
There are no reviews for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M08).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M08) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GFR alpha-1/GDNF R alpha-1 Products
Research Areas for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M08)
Find related products by research area.
|
Blogs on GFR alpha-1/GDNF R alpha-1