GFR alpha-1/GDNF R alpha-1 Antibody (4G3)

Immunocytochemistry/Immunofluorescence: GFR alpha-1/GDNF R alpha-1 Antibody (4G3) [H00002674-M08] - Analysis of monoclonal antibody to GFRA1 on HeLa cell. Antibody concentration 10 ug/ml

Product Discontinued

GFR alpha-1/GDNF R alpha-1 Antibody (4G3) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GFRA1 (NP_005255, 32 a.a. ~ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS
• Specificity: GFRA1 (4G3)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GFRA1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
• Application Notes: Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GFR alpha-1/GDNF R alpha-1 Antibody (4G3)

• DKFZp313E1012
• DKFZp686J0156
• GDNF family receptor alpha 1
• GDNF family receptor alpha-1
• GDNF R alpha-1
• GDNF receptor alpha-1
• GDNFRAGFR-ALPHA-1
• GDNFR-alpha-1
• GDNFRMGC23045
• GFR alpha1
• GFR alpha-1
• GFRA1
• GFRa-1
• GFR-alpha-1
• Glial cell line-derived neurotrophic factor receptor alpha
• GPI-linked anchor protein
• PI-linked cell-surface accessory protein
• RET ligand 1
• RET1L
• RETL1FLJ10561
• TGF-beta related neurotrophic factor receptor 1
• TGF-beta-related neurotrophic factor receptor 1
• TRNR1FLJ31546

Background

Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Two alternatively spliced transcipt variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GFRA1
• Entrez:
  • 2674(Human)
• OMIM:
  • 601496(Human)
• Uniprot:
  • NP_005255()