Gemin 4 Antibody - BSA Free

Western Blot: Gemin 4 Antibody [NBP2-55998] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: Gemin 4 Antibody [NBP2-55998] - Staining of human cell line A549 shows localization to nuclear bodies & cytosol.

Western Blot: Gemin 4 Antibody [NBP2-55998] - Analysis in human cell lines A-549 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Gemin 4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Gemin 4 Antibody - BSA Free (NBP2-55998) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GEMIN4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Gemin 4 Recombinant Protein Antigen (NBP2-55998PEP)

Reactivity Notes

Mouse 84%, Rat 82%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Gemin 4 Antibody - BSA Free

• component of gems 4
• DKFZp434B131
• DKFZP434D174
• gem (nuclear organelle) associated protein 4
• gemin-4
• HC56
• HCAP1
• HCC-associated protein 1
• HHRF-1
• p97DKFZp434D174

Background

The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes required for pre-mRNA splicing in the nucleus. The encoded protein directly interacts with a DEAD box protein and several spliceosome core proteins. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GEMIN4