GDC Antibody

Western Blot: GDC Antibody [NBP1-91933] - Analysis in control (vector only transfected HEK293T lysate) and SLC25A16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: GDC Antibody [NBP1-91933] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.

Product Discontinued

GDC Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLY
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GDC Protein (NBP1-91933PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GDC Antibody

• D10S105EGDC
• GDASolute carrier family 25 member 16
• Graves disease autoantigen
• graves disease carrier protein
• HGT.1
• hML7
• member 16
• MGC39851
• Mitochondrial solute carrier protein homolog
• ML7
• solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen)

Background

GDC encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A16