gamma-2 Tubulin Antibody (4F6)

Images

 
Western Blot: gamma-2 Tubulin Antibody (4F6) [H00027175-M01] - TUBG2 monoclonal antibody (M01), clone 4F6 Analysis of TUBG2 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: gamma-2 Tubulin Antibody (4F6) [H00027175-M01] - Analysis of monoclonal antibody to TUBG2 on HeLa cell. Antibody concentration 25 ug/ml.
Sandwich ELISA: gamma-2 Tubulin Antibody (4F6) [H00027175-M01] - Detection limit for recombinant GST tagged TUBG2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

gamma-2 Tubulin Antibody (4F6) Summary

Immunogen
TUBG2 (NP_057521, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFAT EGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAK LYNPENIYLSEHGGGA
Localization
Centrosomal
Specificity
TUBG2 - tubulin, gamma 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TUBG2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for gamma-2 Tubulin Antibody (4F6)

  • gamma-2-tubulin
  • MGC131994
  • tubulin gamma-2 chain
  • tubulin, gamma 2

Background

Gamma tubulin, a member of the tubulin superfamily, is a ubiquitous and highly conserved protein within the microtubule organizing centre (MTOC). Gamma tubulin is not a component of microtubules, rather it functions as the microtubule nucleator at the MOTC, is responsible for binding microtubule minus ends and mediating the link between microtubles and the centrosome. By binding to the beta tubulin subunit of the tubulin molecule, it establishes the polarity of a microtubule leaving the alpha tubulin subunit exposed at the positive end. The abundance of Gamma tubulin is less than 1% of the level of either alpha or beta tubulin. It shares approximately 28-32% identity with alpha tubulin from various organisms and 32-36% identity with beta tubulins. The detection, localization and characterization of proteins involved in microtubule function is fundamental to the understanding of mitosis, meiosis and the microtubule cytoskeleton.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-574
Species: Hu, Mu, Rt, Po, Bv, Ch, Pl, Pr
Applications: WB, ICC/IF
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
MAB1195
Species: Multi
Applications: WB, Simple Western, IHC, ICC
NBP1-85521
Species: Hu
Applications: WB, IHC, IHC-P
H00004154-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-92547
Species: Hu
Applications: WB, IHC, IHC-P
AF7548
Species: Hu
Applications: IHC
NBP1-90313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
H00009275-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-30941
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for gamma-2 Tubulin Antibody (H00027175-M01) (0)

There are no publications for gamma-2 Tubulin Antibody (H00027175-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gamma-2 Tubulin Antibody (H00027175-M01) (0)

There are no reviews for gamma-2 Tubulin Antibody (H00027175-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for gamma-2 Tubulin Antibody (H00027175-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for gamma-2 Tubulin Antibody (H00027175-M01)

Discover related pathways, diseases and genes to gamma-2 Tubulin Antibody (H00027175-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gamma-2 Tubulin Antibody (H00027175-M01)

Discover more about diseases related to gamma-2 Tubulin Antibody (H00027175-M01).
 

Pathways for gamma-2 Tubulin Antibody (H00027175-M01)

View related products by pathway.

Research Areas for gamma-2 Tubulin Antibody (H00027175-M01)

Find related products by research area.

Blogs on gamma-2 Tubulin

There are no specific blogs for gamma-2 Tubulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gamma-2 Tubulin Antibody (4F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBG2
Entrez
OMIM
Uniprot