GCM1 Antibody (4E8.)


Western Blot: GCM1 Antibody (4E8) [H00008521-M04] - Analysis of GCM1 expression in FHs 173 WE.
Immunocytochemistry/ Immunofluorescence: GCM1 Antibody (4E8) [H00008521-M04] - Analysis of monoclonal antibody to GCM1 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: GCM1 Antibody (4E8) [H00008521-M04] - Detection limit for recombinant GST tagged GCM1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF

Order Details

GCM1 Antibody (4E8.) Summary

GCM1 (NP_003634, 108 a.a. - 166 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*
GCM1 - glial cells missing homolog 1 (Drosophila)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for IF and ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GCM1 Antibody (4E8.)

  • GCM motif protein 1
  • GCMA
  • glial cells missing (Drosophila) homolog a
  • glial cells missing homolog 1 (Drosophila)
  • Glial cells missing homolog 1
  • hGCMachorion-specific transcription factor GCMa


This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, B/N, IHC-Fr, IHC-P, In vitro
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for GCM1 Antibody (H00008521-M04) (0)

There are no publications for GCM1 Antibody (H00008521-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCM1 Antibody (H00008521-M04) (0)

There are no reviews for GCM1 Antibody (H00008521-M04). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GCM1 Antibody (H00008521-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GCM1 Antibody (4E8.) Products

Related Products by Gene

Bioinformatics Tool for GCM1 Antibody (H00008521-M04)

Discover related pathways, diseases and genes to GCM1 Antibody (H00008521-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCM1 Antibody (H00008521-M04)

Discover more about diseases related to GCM1 Antibody (H00008521-M04).

Pathways for GCM1 Antibody (H00008521-M04)

View related products by pathway.

PTMs for GCM1 Antibody (H00008521-M04)

Learn more about PTMs related to GCM1 Antibody (H00008521-M04).

Blogs on GCM1

There are no specific blogs for GCM1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GCM1 Antibody (4E8.) and receive a gift card or discount.


Gene Symbol GCM1

Customers Who Bought This Also Bought