GCM1 Antibody (3D3)

Images

 
Western Blot: GCM1 Antibody (3D3) [H00008521-M06] - Analysis of GCM1 expression in FHs 173 WE.
Immunocytochemistry/ Immunofluorescence: GCM1 Antibody (3D3) [H00008521-M06] - Analysis of monoclonal antibody to GCM1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: GCM1 Antibody (3D3) [H00008521-M06] - Detection limit for recombinant GST tagged GCM1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GCM1 Antibody (3D3) Summary

Immunogen
GCM1 (NP_003634, 108 a.a. - 166 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*
Specificity
GCM1 - glial cells missing homolog 1 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GCM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GCM1 Antibody (3D3)

  • GCM motif protein 1
  • GCMA
  • glial cells missing (Drosophila) homolog a
  • glial cells missing homolog 1 (Drosophila)
  • Glial cells missing homolog 1
  • hGCMachorion-specific transcription factor GCMa

Background

This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-93579
Species: Hu
Applications: WB, B/N, IHC-Fr, IHC-P, In vitro
44880002
Species: Hu
Applications: WB, ELISA
NBP1-82503
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1300
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP1-89327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6539
Species: Hu
Applications: WB, IHC
NBP2-00576
Species: Hu
Applications: WB, Flow, ICC/IF
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46376
Species: Hu
Applications: WB, IHC
H00005956-R02
Species: Hu

Publications for GCM1 Antibody (H00008521-M06) (0)

There are no publications for GCM1 Antibody (H00008521-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCM1 Antibody (H00008521-M06) (0)

There are no reviews for GCM1 Antibody (H00008521-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GCM1 Antibody (H00008521-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCM1 Products

Bioinformatics Tool for GCM1 Antibody (H00008521-M06)

Discover related pathways, diseases and genes to GCM1 Antibody (H00008521-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCM1 Antibody (H00008521-M06)

Discover more about diseases related to GCM1 Antibody (H00008521-M06).
 

Pathways for GCM1 Antibody (H00008521-M06)

View related products by pathway.

PTMs for GCM1 Antibody (H00008521-M06)

Learn more about PTMs related to GCM1 Antibody (H00008521-M06).

Blogs on GCM1

There are no specific blogs for GCM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCM1 Antibody (3D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol GCM1
Entrez
OMIM
Uniprot