GCLM Antibody - BSA Free

Western Blot: GCLM Antibody [NBP1-83361] - Analysis in human cell line U-251 MG and human cell line MCF-7.

Immunocytochemistry/Immunofluorescence: GCLM Antibody [NBP1-83361] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: GCLM Antibody [NBP1-83361] - Staining of human thyroid gland shows strong cytoplasmic positivity with a granular pattern in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GCLM Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GCLM Antibody - BSA Free (NBP1-83361) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCLM
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GCLM Protein (NBP1-83361PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GCLM Antibody - BSA Free

• Gamma-ECS regulatory subunit
• Gamma-glutamylcysteine synthetase regulatory subunit
• GCS light chain
• GLCLRglutamate--cysteine ligase regulatory subunit
• glutamate-cysteine ligase (gamma-glutamylcysteine synthetase), regulatory(30.8kD)
• Glutamate--cysteine ligase modifier subunit
• glutamate-cysteine ligase regulatory protein
• glutamate-cysteine ligase, modifier subunit
• GSC light chain

Background

Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GCLM