GCLM Antibody

Images

 
Western Blot: GCLM Antibody [NBP1-83361] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: GCLM Antibody [NBP1-83361] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: GCLM Antibody [NBP1-83361] - Staining of human thyroid gland shows strong cytoplasmic positivity with a granular pattern in glandular cells.
Western Blot: GCLM Antibody [NBP1-83361] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCLM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCLM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GCLM Protein (NBP1-83361PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCLM Antibody

  • Gamma-ECS regulatory subunit
  • Gamma-glutamylcysteine synthetase regulatory subunit
  • GCS light chain
  • GLCLRglutamate--cysteine ligase regulatory subunit
  • glutamate-cysteine ligase (gamma-glutamylcysteine synthetase), regulatory(30.8kD)
  • Glutamate--cysteine ligase modifier subunit
  • glutamate-cysteine ligase regulatory protein
  • glutamate-cysteine ligase, modifier subunit
  • GSC light chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-88505
Species: Hu
Applications: IHC, IHC-P
H00064396-P01
Species: Hu
NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03351
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-03319
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P

Publications for GCLM Antibody (NBP1-83361) (0)

There are no publications for GCLM Antibody (NBP1-83361).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCLM Antibody (NBP1-83361) (0)

There are no reviews for GCLM Antibody (NBP1-83361). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GCLM Antibody (NBP1-83361) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCLM Products

Bioinformatics Tool for GCLM Antibody (NBP1-83361)

Discover related pathways, diseases and genes to GCLM Antibody (NBP1-83361). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCLM Antibody (NBP1-83361)

Discover more about diseases related to GCLM Antibody (NBP1-83361).
 

Pathways for GCLM Antibody (NBP1-83361)

View related products by pathway.

PTMs for GCLM Antibody (NBP1-83361)

Learn more about PTMs related to GCLM Antibody (NBP1-83361).
 

Research Areas for GCLM Antibody (NBP1-83361)

Find related products by research area.

Blogs on GCLM

There are no specific blogs for GCLM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCLM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCLM