GCLM Antibody


Western Blot: GCLM Antibody [NBP1-83361] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: GCLM Antibody [NBP1-83361] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: GCLM Antibody [NBP1-83361] - Staining of human thyroid gland shows strong cytoplasmic positivity with a granular pattern in glandular cells.
Western Blot: GCLM Antibody [NBP1-83361] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

GCLM Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE
Specificity of human, mouse, rat GCLM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GCLM Protein (NBP1-83361PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GCLM Antibody

  • Gamma-ECS regulatory subunit
  • Gamma-glutamylcysteine synthetase regulatory subunit
  • GCS light chain
  • GLCLRglutamate--cysteine ligase regulatory subunit
  • glutamate-cysteine ligase (gamma-glutamylcysteine synthetase), regulatory(30.8kD)
  • Glutamate--cysteine ligase modifier subunit
  • glutamate-cysteine ligase regulatory protein
  • glutamate-cysteine ligase, modifier subunit
  • GSC light chain


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Ye
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P

Publications for GCLM Antibody (NBP1-83361) (0)

There are no publications for GCLM Antibody (NBP1-83361).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCLM Antibody (NBP1-83361) (0)

There are no reviews for GCLM Antibody (NBP1-83361). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GCLM Antibody (NBP1-83361) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GCLM Products

Bioinformatics Tool for GCLM Antibody (NBP1-83361)

Discover related pathways, diseases and genes to GCLM Antibody (NBP1-83361). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCLM Antibody (NBP1-83361)

Discover more about diseases related to GCLM Antibody (NBP1-83361).

Pathways for GCLM Antibody (NBP1-83361)

View related products by pathway.

PTMs for GCLM Antibody (NBP1-83361)

Learn more about PTMs related to GCLM Antibody (NBP1-83361).

Research Areas for GCLM Antibody (NBP1-83361)

Find related products by research area.

Blogs on GCLM

There are no specific blogs for GCLM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GCLM Antibody and receive a gift card or discount.


Gene Symbol GCLM