GBP6 Antibody

Images

 
Western Blot: GBP6 Antibody [NBP1-84117] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: GBP6 Antibody [NBP1-84117] - Staining of human esophagus shows weak cytoplasmic and nuclear positivity in superficial layers of squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GBP6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GBP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GBP6 Protein (NBP1-84117PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GBP6 Antibody

  • DKFZp686G0786
  • FLJ39135
  • GBP-6
  • GTP-binding protein 6
  • Guanine nucleotide-binding protein 6
  • guanylate binding protein family, member 6
  • guanylate-binding protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03972
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59008
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14731
Species: Hu
Applications: IHC, IHC-P
AF-261-NA
Species: Hu
Applications: WB, IHC, Neut
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-74541
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5170
Species: Hu
Applications: WB, Simple Western, Block
AF7715
Species: Hu
Applications: WB, IHC
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for GBP6 Antibody (NBP1-84117) (0)

There are no publications for GBP6 Antibody (NBP1-84117).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GBP6 Antibody (NBP1-84117) (0)

There are no reviews for GBP6 Antibody (NBP1-84117). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GBP6 Antibody (NBP1-84117) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GBP6 Products

Bioinformatics Tool for GBP6 Antibody (NBP1-84117)

Discover related pathways, diseases and genes to GBP6 Antibody (NBP1-84117). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GBP6 Antibody (NBP1-84117)

Discover more about diseases related to GBP6 Antibody (NBP1-84117).
 

Pathways for GBP6 Antibody (NBP1-84117)

View related products by pathway.

Blogs on GBP6

There are no specific blogs for GBP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GBP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GBP6