GBA2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GBA2 Antibody [NBP1-89251] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: GBA2 Antibody [NBP1-89251] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry: GBA2 Antibody [NBP1-89251] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GBA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HDTADWKDLNLKFVLQVYRDYYLTGDQNFLKDMWPVCLAVMESEMKFDKDHDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAALCGAQDIQDKFSSILSRGQEAYERLLWNGRYYNYDSSSRPQSRSVMSDQCA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GBA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GBA2 Protein (NBP1-89251PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GBA2 Antibody

  • AD035
  • Beta-glucocerebrosidase 2
  • Beta-glucosidase 2
  • bile acid beta-glucosidase
  • DKFZp762K054
  • glucosidase, beta (bile acid) 2
  • Glucosylceramidase 2
  • KIAA1605EC 3.2.1.45
  • MGC16895
  • NLGase
  • non-lysosomal glucosylceramidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00007357-M03
Species: Hu
Applications: WB, ELISA
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-04611
Species: Hu
NBP1-84012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-48694
Species: Hu
Applications: IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for GBA2 Antibody (NBP1-89251) (0)

There are no publications for GBA2 Antibody (NBP1-89251).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GBA2 Antibody (NBP1-89251) (0)

There are no reviews for GBA2 Antibody (NBP1-89251). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GBA2 Antibody (NBP1-89251) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GBA2 Products

Bioinformatics Tool for GBA2 Antibody (NBP1-89251)

Discover related pathways, diseases and genes to GBA2 Antibody (NBP1-89251). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GBA2 Antibody (NBP1-89251)

Discover more about diseases related to GBA2 Antibody (NBP1-89251).
 

Pathways for GBA2 Antibody (NBP1-89251)

View related products by pathway.

PTMs for GBA2 Antibody (NBP1-89251)

Learn more about PTMs related to GBA2 Antibody (NBP1-89251).
 

Research Areas for GBA2 Antibody (NBP1-89251)

Find related products by research area.

Blogs on GBA2

There are no specific blogs for GBA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GBA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GBA2
Entrez
Uniprot