GATA-3 Antibody

Immunohistochemistry-Paraffin: GATA-3 Antibody [NBP1-83271] - Staining of human skin shows strong nuclear positivity in keratinocytes.

Immunohistochemistry-Paraffin: GATA-3 Antibody [NBP1-83271] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: GATA-3 Antibody [NBP1-83271] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: GATA-3 Antibody [NBP1-83271] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.

Product Discontinued

GATA-3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHP
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GATA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GATA-3 Antibody

• 131320
• GATA binding protein 3
• GATA3
• GATA-3
• GATA-binding factor 3
• GATA-binding protein 3
• HDRMGC5199
• MGC2346
• MGC5445
• trans-acting T-cell-specific transcription factor GATA-3

Background

The GATA3 gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains twoGATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelialcell biology. Defects in th

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GATA3