Novus Biologicals products are now on bio-techne.com

GAT-1/SLC6A1 Antibody

Images

 
Western Blot: GAT1 Antibody [NBP1-59878] - Mouse Brain lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: GAT1 Antibody [NBP1-59878] - mouse brain slices, 1:1000

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

GAT-1/SLC6A1 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to SLC6A1(solute carrier family 6 (neurotransmitter transporter, GABA), member 1) The peptide sequence was selected from the middle region of SLC6A1. Peptide sequence CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-59878 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for GAT-1/SLC6A1 Antibody

  • GABA Transporter 1
  • GABATHG
  • GABATR
  • GABATRGAT-1
  • GABT1
  • GAT1
  • GAT-1
  • GAT1sodium- and chloride-dependent GABA transporter 1
  • SLC6A1
  • solute carrier family 6 (neurotransmitter transporter, GABA), member 1
  • Solute carrier family 6 member 1

Background

SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91920
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88641
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1872
Species: Hu, Mu, Rt
Applications: Flow, WB
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF2247
Species: Hu
Applications: IHC, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-20857
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-20136
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, In vivo, ISH, WB
NB120-11427
Species: Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-87992
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-21598
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-59319
Species: Hu, Rt
Applications: ICC/IF, IP, WB
NB100-1869
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00000761-M02
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
NBP3-12251
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for GAT-1/SLC6A1 Antibody (NBP1-59878)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GAT-1/SLC6A1 Antibody (NBP1-59878) (0)

There are no reviews for GAT-1/SLC6A1 Antibody (NBP1-59878). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAT-1/SLC6A1 Antibody (NBP1-59878) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAT-1/SLC6A1 Products

Research Areas for GAT-1/SLC6A1 Antibody (NBP1-59878)

Find related products by research area.

Blogs on GAT-1/SLC6A1

There are no specific blogs for GAT-1/SLC6A1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAT-1/SLC6A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A1
Uniprot