Gastrokine 2 Antibody

Images

 
Western Blot: Gastrokine 2 Antibody [NBP2-82875] - WB Suggested Anti-GKN2 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Gastrokine 2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Gastrokine 2. Peptide sequence: NIISPSNNGGNVQETVTIDNEKNTAIINIHAGSCSSTTIFDYKHGYIASR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GKN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Gastrokine 2 Antibody

  • BlblDown-regulated in gastric cancer
  • BLOT
  • down regulated in gastric cancer GDDR
  • gastrokine 2
  • GDDRdown-regulated in gastric cancer GDDR
  • PRO813
  • TFIZ1gastrokine-2
  • Trefoil factor interactions(z) 1
  • VLTI465

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00056287-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-90813
Species: Hu
Applications: IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
MAB4077
Species: Hu
Applications: IHC, WB
NBP1-87201
Species: Hu
Applications: IHC, IHC-P, WB
MAB59151
Species: Mu
Applications: WB
DTFF30
Species: Hu
Applications: ELISA
NBL1-08611
Species: Hu
Applications: WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
1277-JG
Species: Hu
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF4904
Species: Hu
Applications: WB
H00055079-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-82875
Species: Hu
Applications: WB

Publications for Gastrokine 2 Antibody (NBP2-82875) (0)

There are no publications for Gastrokine 2 Antibody (NBP2-82875).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gastrokine 2 Antibody (NBP2-82875) (0)

There are no reviews for Gastrokine 2 Antibody (NBP2-82875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gastrokine 2 Antibody (NBP2-82875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gastrokine 2 Products

Bioinformatics Tool for Gastrokine 2 Antibody (NBP2-82875)

Discover related pathways, diseases and genes to Gastrokine 2 Antibody (NBP2-82875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gastrokine 2 Antibody (NBP2-82875)

Discover more about diseases related to Gastrokine 2 Antibody (NBP2-82875).
 

Pathways for Gastrokine 2 Antibody (NBP2-82875)

View related products by pathway.

PTMs for Gastrokine 2 Antibody (NBP2-82875)

Learn more about PTMs related to Gastrokine 2 Antibody (NBP2-82875).

Blogs on Gastrokine 2

There are no specific blogs for Gastrokine 2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gastrokine 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GKN2