Gastrokine 1 Antibody (2E5) Summary
Immunogen |
GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN |
Specificity |
GKN1 - gastrokine 1 |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
GKN1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500
- ELISA
- Immunocytochemistry/Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
|
Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
Publications |
|
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Gastrokine 1 Antibody (2E5)
Background
The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Publications for Gastrokine 1 Antibody (H00056287-M01)(6)
Showing Publications 1 -
6 of 6.
Publications using H00056287-M01 |
Applications |
Species |
Villano V, Di Stadio CS, Federico A et al. Gastrokine 1 mRNA in human sera is not informative biomarker for gastric cancer. J Negat Results Biomed 2016 Jul 25 [PMID: 27452910] |
|
|
Altieri F, Di Stadio CS, Severino V et al. Anti-amyloidogenic property of human gastrokine 1. Biochimie. 2014 Aug 17 [PMID: 25139219] |
|
|
Mao W, Chen J, Peng TL et al. Helicobacter pylori infection and administration of non-steroidal anti-inflammatory drugs down-regulate the expression of gastrokine-1 in gastric mucosa. Turk J Gastroenterol. 2012 Jun 01 [PMID: 22798109] |
|
|
Mao W, Chen J, Peng TL et al. Downregulation of gastrokine-1 in gastric cancer tissues and restoration of its expression induced gastric cancer cells to apoptosis. J Exp Clin Cancer Res. 2012 May 23 [PMID: 22621392] |
|
|
Kam SY, Hennessy T, Chua SC et al. Characterization of the Human Gastric Fluid Proteome Reveals Distinct pH-Dependent Protein Profiles: Implications for Biomarker Studies. J Proteome Res. 2011 Aug 15 [PMID: 21842849] |
|
|
Rippa E, La Monica G, Allocca R et al. Overexpression of gastrokine 1 in gastric cancer cells induces fas-mediated apoptosis. J Cell Physiol. 2010 Dec 28 [PMID: 21190249] |
|
|
Reviews for Gastrokine 1 Antibody (H00056287-M01) (0)
There are no reviews for Gastrokine 1 Antibody (H00056287-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Gastrokine 1 Antibody (H00056287-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional Gastrokine 1 Products
Bioinformatics Tool for Gastrokine 1 Antibody (H00056287-M01)
Discover related pathways, diseases and genes to Gastrokine 1 Antibody (H00056287-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Gastrokine 1 Antibody (H00056287-M01)
Discover more about diseases related to Gastrokine 1 Antibody (H00056287-M01).
| | Pathways for Gastrokine 1 Antibody (H00056287-M01)
View related products by pathway.
|
PTMs for Gastrokine 1 Antibody (H00056287-M01)
Learn more about PTMs related to Gastrokine 1 Antibody (H00056287-M01).
| | Research Areas for Gastrokine 1 Antibody (H00056287-M01)
Find related products by research area.
|
Blogs on Gastrokine 1