Home » Gastrokine 1 » Gastrokine 1 Antibodies » Gastrokine 1 Antibody (2E5)

Gastrokine 1 Antibody (2E5)

 (6 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Gastrokine 1 Antibody (2E5) [H00056287-M01] - Analysis of GKN1 expression in transfected 293T cell line by GKN1 monoclonal antibody (M01), clone 2E5.Lane 1: GKN1 transfected lysate(20 KDa).Lane 2: Non-transfected lysate.
Western Blot: Gastrokine 1 Antibody (2E5) [H00056287-M01] - Analysis of GKN1 expression in transfected 293T cell line by GKN1 monoclonal antibody (M01), clone 2E5.Lane 1: GKN1 transfected lysate(20 KDa).Lane 2: ...read more
Sandwich ELISA: Gastrokine 1 Antibody (2E5) [H00056287-M01] - Detection limit for recombinant GST tagged GKN1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Gastrokine 1 Antibody (2E5) Summary

Immunogen
GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Specificity
GKN1 - gastrokine 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GKN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using H00056287-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Gastrokine 1 Antibody (2E5)

  • 18 kDa antrum mucosa protein
  • AMP18
  • AMP-18
  • AMP18BRICHOS domain containing 1
  • BRICD1
  • CA11
  • CA11MGC70354
  • FOV
  • Foveolin
  • Gastrokine 1
  • gastrokine-1
  • GKN1
  • Protein CA11

Background

The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...


TMEFF2/Tomoregulin-2 A
NBP2-01863
Western Blot: TMEFF2 Antibody (1F9) [NBP2-01863] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TMEFF2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-TMEFF2.
Immunohistochemistry-Paraffin: TMEFF2 Antibody (1F9) [NBP2-01863] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-TMEFF2 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: TMEFF2 Antibody (1F9) [NBP2-01863] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-TMEFF2 mouse monoclonal antibody.
Species: Hu, Mu
Applications: IHC, IHC-P, WB
PAR1/Thrombin
Receptor Antibody (N2
NBP1-71770
Western Blot: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of PAR1 in whole cell lysate of Neuro2A cell line using 4ug/ml concentration of PAR1 antibody (clone N2-11). The antibody detected a strong band at ~60kDa position and another light band at ~80kDa, both of which appears to be the glycosylated forms of PAR1 protein.
Immunocytochemistry/Immunofluorescence: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Thrombin Receptor antibody was tested in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor on mouse skin using NBP1-71770.
(8 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Thioredoxin
Reductase 1/TRXR1 Ant
NBP2-20619
Western Blot: thioredoxin reductase 1 Antibody [NBP2-20619] - Sample (30 ug of whole cell lysate)A: Molt-4 7. 5% SDS PAGE gel, diluted at 1:3000.
Western Blot: thioredoxin reductase 1 Antibody [NBP2-20619] - 50 ug mouse brain lysate/extract 7. 5% SDS-PAGE TrxR1 antibody [N3C2], Internal dilution: 1:1000.
Western Blot: thioredoxin reductase 1 Antibody [NBP2-20619] - 50 ug Rat brain lysate/extract 7. 5% SDS-PAGE TrxR1 antibody [N3C2], Internal dilution: 1:1000.
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TfR (Transferrin
R) Antibody (OX26) - ...
NB200-585
Western Blot: TfR (Transferrin R) Antibody (OX26) [NB200-585] - Total protein from rat adrenal gland cells (PC12) and rat placenta was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-CD71 in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Flow Cytometry: TfR (Transferrin R) Antibody (OX26) [NB200-585] - Staining of rat spleen cells with mouse anti rat CD71: RPE.
Immunocytochemistry/Immunofluorescence: TfR (Transferrin R) Antibody (OX26) [NB200-585] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti TfR/Transferrin R (OX26) NB200-585 at a 1:100 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (red) at a 1:200 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.
(16 Publications)
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
TXNRD2 Antibody
NBP2-94256
Immunohistochemistry-Paraffin: TXNRD2 Antibody [NBP2-94256] - Paraffin-embedded human liver cancer using TXNRD2 .
Western Blot: TXNRD2 Antibody [NBP2-94256] - Analysis of extracts of various cell lines, using TXNRD2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.
Immunohistochemistry-Paraffin: TXNRD2 Antibody [NBP2-94256] - Paraffin-embedded human liver damage using TXNRD2 .
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Gastrokine 2
Antibody
NBP2-31688
Immunohistochemistry-Paraffin: Gastrokine 2 Antibody [NBP2-31688] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Gastrokine 2 Antibody [NBP2-31688] - Staining in human stomach and pancreas tissues using anti-GKN2 antibody. Corresponding GKN2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Gastrokine 2 Antibody [NBP2-31688] - Staining of human stomach shows high expression.
Species: Hu
Applications: IHC, IHC-P
Fucosyltransferase
2/FUT2 Antibody
NBP2-26116
Immunohistochemistry-Paraffin: Fucosyltransferase 2/FUT2 Antibody [NBP2-26116] - Staining of Human Placenta. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: Fucosyltransferase 2/FUT2 Antibody [NBP2-26116] - Staining of Human Liver lysate (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
SQLE Antibody
NBP2-32005
Western Blot: SQLE Antibody [NBP2-32005] - Analysis in human cell line MCF-7 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Species: Hu
Applications: IHC, IHC-P, WB
TFF1/pS2 Antibody
NBP1-90813
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human stomach shows high expression.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining in human stomach and liver tissues using anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same tissues.
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
TFPI [HRP]
DTFP10
(10 Publications)
Species: Hu
Applications: ELISA
Carbonic Anhydrase
X/CA10 Antibody
NBP2-31586
Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.
Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of pancreas.
Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of liver cancer.
Species: Hu
Applications: IHC, IHC-P
Carbonic Anhydrase
VIII/CA8 Antibody [Un ...
AF2187
Western blot shows lysates of human brain (cerebellum) tissue and mouse brain (cerebellum) tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse Carbonic Anhydrase VIII/CA8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2187) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Carbonic Anhydrase VIII/CA8 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human brain (cerebellum) tissue and mouse brain (cerebellum) tissue, loaded at 0.2 mg/mL. Specific bands were detected for Carbonic Anhydrase VIII/CA8 at approximately 41 and 50 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse Carbonic Anhydrase VIII/CA8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2187) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu
Applications: IP, Simple Western, WB
Glycophorin C
Antibody
NBP1-84597
Western Blot: Glycophorin C Antibody [NBP1-84597] - Analysis in control (vector only transfected HEK293T lysate) and GYPC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Analysis in human bone marrow and pancreas tissues using NBP1-84597 antibody. Corresponding GYPC RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human bone marrow shows strong membranous positivity in erythrocytes.
Species: Hu
Applications: IHC, IHC-P, WB
Neutrophil
Elastase/ELA2 Antibod ...
MAB9167
Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Rabbit IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils .
Flow Cytometry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - THP-1 human acute monocytic leukemia cell line treated with 3 uM monensin for 3 hours was stained with Mouse Anti-Human Neutrophil Elastase/ELA2 Monoclonal Antibody (Catalog # MAB9167, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005).
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Jagged 1
[Unconjugated]
1277-JG
Jagged 1 [Unconjugated]
(2 Reviews)
(37 Publications)
Species: Hu
Applications: BA
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of HeLa cells using Adenine Nucleotide Translocator 2 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Paraffin-embedded mouse heart using Adenine Nucleotide Translocator 2 .
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of extracts of various cell lines, using Adenine Nucleotide Translocator 2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MUC5AC Antibody
(45M1)
NBP2-15196
Flow Cytometry: MUC5AC Antibody (45M1) [NBP2-15196] - Analysis using the Azide and BSA Free version of NBP2-15196. Staining of fixed (70% ethanol or 80% methanol) and permeabilized A549 cells
Immunohistochemistry-Paraffin: MUC5AC Antibody (45M1) [NBP2-15196] - Analysis using the Azide and BSA Free version of NBP2-15196. Detection Human stomach.
Flow (Intracellular): MUC5AC Antibody (45M1) [NBP2-15196] - An intracellular stain was performed on A549 cells with Mucin 5AC (45M1) antibody NBP2-15196 (blue) and a matched isotype control NBP2-27287 (orange). To block the secretion of Mucin 5AC, cells were treated with 3uM Monensin for 3 hours. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).
(5 Reviews)
(13 Publications)
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
FACA/FANCA Antibody
NB100-2564
Western Blot: FACA/FANCA Antibody [NB100-2564] - Detection of FANC A in transfected COS1 cell lysate.
(1 Publication)
Species: Hu
Applications: WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Flow Cytometry: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Frataxin antibody, and then analyzed by flow cytometry.
Western Blot: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Frataxin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Frataxin.
Immunohistochemistry-Paraffin: Frataxin Antibody (1C12) [NBP2-01743] - Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-Frataxin mouse monoclonal antibody.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for Gastrokine 1 Antibody (H00056287-M01)(6)


Reviews for Gastrokine 1 Antibody (H00056287-M01) (0)

There are no reviews for Gastrokine 1 Antibody (H00056287-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Gastrokine 1 Antibody (H00056287-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gastrokine 1 Products

Bioinformatics Tool for Gastrokine 1 Antibody (H00056287-M01)

Discover related pathways, diseases and genes to Gastrokine 1 Antibody (H00056287-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gastrokine 1 Antibody (H00056287-M01)

Discover more about diseases related to Gastrokine 1 Antibody (H00056287-M01).
 

Pathways for Gastrokine 1 Antibody (H00056287-M01)

View related products by pathway.

PTMs for Gastrokine 1 Antibody (H00056287-M01)

Learn more about PTMs related to Gastrokine 1 Antibody (H00056287-M01).
 

Research Areas for Gastrokine 1 Antibody (H00056287-M01)

Find related products by research area.

Blogs on Gastrokine 1

There are no specific blogs for Gastrokine 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gastrokine 1 Antibody (2E5) and receive a gift card or discount.


Bioinformatics

Gene Symbol GKN1
Entrez
OMIM
Uniprot