Home » Gastrokine 1 » Gastrokine 1 Antibodies » Gastrokine 1 Antibody (2E5)

Gastrokine 1 Antibody (2E5)

 (6 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Gastrokine 1 Antibody (2E5) [H00056287-M01] - Analysis of GKN1 expression in transfected 293T cell line by GKN1 monoclonal antibody (M01), clone 2E5.Lane 1: GKN1 transfected lysate(20 KDa).Lane 2: Non-transfected lysate.
Western Blot: Gastrokine 1 Antibody (2E5) [H00056287-M01] - Analysis of GKN1 expression in transfected 293T cell line by GKN1 monoclonal antibody (M01), clone 2E5.Lane 1: GKN1 transfected lysate(20 KDa).Lane 2: ...read more
Sandwich ELISA: Gastrokine 1 Antibody (2E5) [H00056287-M01] - Detection limit for recombinant GST tagged GKN1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Gastrokine 1 Antibody (2E5) Summary

Immunogen
GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Specificity
GKN1 - gastrokine 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GKN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using H00056287-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Gastrokine 1 Antibody (2E5)

  • 18 kDa antrum mucosa protein
  • AMP18
  • AMP-18
  • AMP18BRICHOS domain containing 1
  • BRICD1
  • CA11
  • CA11MGC70354
  • FOV
  • Foveolin
  • Gastrokine 1
  • gastrokine-1
  • GKN1
  • Protein CA11

Background

The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...


TMEFF2/Tomoregulin-2 A
NBP2-01863
Western Blot: TMEFF2 Antibody (1F9) [NBP2-01863] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TMEFF2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-TMEFF2.
Immunohistochemistry-Paraffin: TMEFF2 Antibody (1F9) [NBP2-01863] Staining of paraffin-embedded Human tonsil using anti-TMEFF2 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: TMEFF2 Antibody (1F9) [NBP2-01863] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-TMEFF2 mouse monoclonal antibody.
Species: Hu
Applications: WB, IHC, IHC-P
PAR1/Thrombin
Receptor Antibody (N2
NBP1-71770
Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - PAR1 is expressed by neural stem cells in the sub-ventricular zone (SVZ) of the adult mouse brain. Photomicrographs show immunofluorescence double-labeling for PAR1 with Sox2-positive multipotent neural stem cells (NSCs) within the lateral wall of the lateral ventricle (LV). RNAscope was used to identify cells expressing both PAR1 and Sox2. RNA in NSCs of the adult SVZ. Arrow indicates an example of a double-labeled cell in each case, with arrowhead indicating a singly labeled cell (Scale bar = 10 um). Boxed area in B is also shown at higher magnification to visualize double-labeled cells. Image collected and cropped by Cite Ab from the following publication (The Thrombin Receptor Restricts Subventricular Zone Neural Stem Cell Expansion and Differentiation. Sci Rep (2018) licensed under a CC-BY licence.
Western Blot: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor expression in human testis using NBP1-71770.
Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - PAR1 is expressed by neural stem cells in the sub-ventricular zone (SVZ) of the adult mouse brain. Photomicrographs show immunofluorescence double-labeling for PAR1 with Nestin-positive multipotent neural stem cells (NSCs) within the lateral wall of the lateral ventricle (LV). RNAscope was used to identify cells expressing both PAR1 and Nestin. RNA in NSCs of the adult SVZ. Arrow indicates an example of a double-labeled cell in each case, with arrowhead indicating a singly labeled cell (Scale bar = 10 um). Boxed area in D is also shown at higher magnification to visualize double-labeled cells. Image collected and cropped by Cite Ab from the following publication (The Thrombin Receptor Restricts Subventricular Zone Neural Stem Cell Expansion and Differentiation. Sci Rep (2018) licensed under a CC-BY licence.
(7 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Thioredoxin
Reductase 1/TRXR1 Ant
NBP2-20619
Western Blot: thioredoxin reductase 1 Antibody [NBP2-20619] - 50 ug Rat brain lysate/extract 7. 5% SDS-PAGE TrxR1 antibody [N3C2], Internal dilution: 1:1000.
Immunocytochemistry/Immunofluorescence: thioredoxin reductase 1 Antibody [NBP2-20619] - Analysis of paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Thioredoxin Reductase 1/TRXR1 Antibody [NBP2-20619] - TrxR1 antibody [N3C2], Internal detects TrxR1 protein at cytoplasm and nucleus in mouse liver by Immunohistochemical analysis. Sample: Paraffin-embedded mouse liver. TrxR1 antibody [N3C2], Internal diluted at 1:500.
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
TfR (Transferrin
R) Antibody (OX26)
NB200-585
Western Blot: TfR (Transferrin R) Antibody (OX26) [NB200-585] - Total protein from rat adrenal gland cells (PC12) and rat placenta was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-CD71 in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: TfR (Transferrin R) Antibody (OX26) [NB200-585] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti TfR/Transferrin R (OX26) NB200-585 at a 1:100 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (red) at a 1:200 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody (OX26) [NB200-585] - Analysis of FFPE mouse spleen using TfR (OX26) antibody at 1:50 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Plasma membrane staining was observed. Staining was performed by Histowiz.
(16 Publications)
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
TXNRD2 Antibody
NBP1-86919
Western Blot: TXNRD2 Antibody [NBP1-86919] - Analysis in human cell line K562.
Immunohistochemistry-Paraffin: TXNRD2 Antibody [NBP1-86919] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(4 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
Gastrokine 2
Antibody
NBP2-31688
Immunohistochemistry-Paraffin: Gastrokine 2 Antibody [NBP2-31688] - Staining of human stomach shows high expression.
Immunohistochemistry: Gastrokine 2 Antibody [NBP2-31688] - Staining of stomach cancer.
Immunohistochemistry-Paraffin: Gastrokine 2 Antibody [NBP2-31688] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
Fucosyltransferase
2/FUT2 Antibody
NBP2-26116
Western Blot: Fucosyltransferase 2/FUT2 Antibody [NBP2-26116] - Staining of Human Liver lysate (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Fucosyltransferase 2/FUT2 Antibody [NBP2-26116] - Staining of Human Placenta. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
SQLE Antibody
NBP2-32005
Western Blot: SQLE Antibody [NBP2-32005] - Analysis in human cell line MCF-7 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining in human testis and skeletal muscle tissues using NBP2-32005 antibody. Corresponding SQLE RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
TFF1/pS2 Antibody
NBP1-90813
Western Blot: TFF1/pS2 Antibody [NBP1-90813] - Analysis in ysate from HEK293 cells. Image from a verified customer review.
Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining in human stomach and liver tissues using anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same tissues.
Western Blot: TFF1/pS2 Antibody [NBP1-90813] - Analysis in control (vector only transfected HEK293T lysate) and TFF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
(1 Review)
(4 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
TFPI [HRP]
DTFP10
(8 Publications)
Species: Hu
Carbonic Anhydrase
X/CA10 Antibody
NBP2-31586
Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.
Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of pancreas.
Species: Hu
Applications: IHC, IHC-P
Carbonic Anhydrase
VIII/CA8 Antibody [Un ...
AF2187
Western blot shows lysates of human brain (cerebellum) tissue and mouse brain (cerebellum) tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse Carbonic Anhydrase VIII/CA8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2187) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Carbonic Anhydrase VIII/CA8 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human brain (cerebellum) tissue and mouse brain (cerebellum) tissue, loaded at 0.2 mg/mL. Specific bands were detected for Carbonic Anhydrase VIII/CA8 at approximately 41 and 50 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse Carbonic Anhydrase VIII/CA8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2187) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu
Applications: WB, Simple Western, IP
Glycophorin C
Antibody
NBP1-84597
Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Analysis in human bone marrow and pancreas tissues using NBP1-84597 antibody. Corresponding GYPC RNA-seq data are presented for the same tissues.
Western Blot: Glycophorin C Antibody [NBP1-84597] - Analysis in control (vector only transfected HEK293T lysate) and GYPC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Species: Hu
Applications: WB, IHC, IHC-P
Neutrophil
Elastase/ELA2 Antibod ...
MAB9167
Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Rabbit IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Immunocytochemistry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - Neutrophil Elastase/ELA2 was detected in immersion fixed THP-1 cell using Neutrophil Elastase/ELA2 Monoclonal Antibody at 8 ug/ml dilution. Cells were stained using Donkey anti-Mouse IgG Secondary Antibody [NL557] (red) and counterstained with DAPI (blue). Specific staining was localized to cytoplasmic.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils.
(1 Review)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Jagged 1
[Unconjugated]
1277-JG
Jagged 1 [Unconjugated]
(1 Review)
(27 Publications)
Species: Hu
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-57642
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells and cells in granular layer.
Species: Hu
Applications: WB, IHC, IHC-P
MUC5AC Antibody
(45M1)
NBP2-15196
Western Blot: MUC5AC Antibody (45M1) [NBP2-15196] - AGS human gastric adenocarcinoma and KATO-III human gastric carcinoma cell line lysates. Image from verified customer review.
Immunohistochemistry-Paraffin: MUC5AC Antibody (45M1) [NBP2-15196] - Formalin-fixed, paraffin-embedded human Gastric Carcinoma stained with MUC5AC Monoclonal Antibody (45M1).
Flow Cytometry: MUC5AC Antibody (45M1) [NBP2-15196] - An intracellular stain was performed on A549 cells with Mucin 5AC (45M1) antibody NBP2-15196PE (blue) and a matched isotype control NBP2-27287PE (orange). To block the secretion of Mucin 5AC, cells were treated with 3uM Monensin for 3 hours. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature. Both Antibodies were conjugated to Phycoerythrin.
(4 Reviews)
(11 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
FACA/FANCA Antibody
NB100-2564
Western Blot: FACA/FANCA Antibody [NB100-2564] - Detection of FANC A in transfected COS1 cell lysate.
(1 Publication)
Species: Hu
Applications: WB
PMEL17/SILV
Antibody
NBP1-69571
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, CD45 and CD14 in representative cases from the Lund melanoma cohort. Small panels show zoom-in views, for example, to visualize morphology of CD45+/CD14+ tumour-infiltrating immune cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms9755) licensed under a CC-BY licence.
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.
(7 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Frataxin Antibody
(OTI1C12)
NBP2-01743
Western Blot: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Frataxin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Frataxin.
Immunocytochemistry/Immunofluorescence: Frataxin Antibody (1C12) [NBP2-01743] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Frataxin.
Immunohistochemistry-Paraffin: Frataxin Antibody (1C12) [NBP2-01743] - Staining of paraffin-embedded Human prostate tissue using anti-Frataxin mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Gastrokine 1 Antibody (H00056287-M01)(6)


Reviews for Gastrokine 1 Antibody (H00056287-M01) (0)

There are no reviews for Gastrokine 1 Antibody (H00056287-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Gastrokine 1 Antibody (H00056287-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Gastrokine 1 Products

Bioinformatics Tool for Gastrokine 1 Antibody (H00056287-M01)

Discover related pathways, diseases and genes to Gastrokine 1 Antibody (H00056287-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gastrokine 1 Antibody (H00056287-M01)

Discover more about diseases related to Gastrokine 1 Antibody (H00056287-M01).
 

Pathways for Gastrokine 1 Antibody (H00056287-M01)

View related products by pathway.

PTMs for Gastrokine 1 Antibody (H00056287-M01)

Learn more about PTMs related to Gastrokine 1 Antibody (H00056287-M01).
 

Research Areas for Gastrokine 1 Antibody (H00056287-M01)

Find related products by research area.

Blogs on Gastrokine 1

There are no specific blogs for Gastrokine 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gastrokine 1 Antibody (2E5) and receive a gift card or discount.


Bioinformatics

Gene Symbol GKN1
Entrez
OMIM
Uniprot