Gastrokine 1 Antibody (2E5)

Images

 
Western Blot: Gastrokine 1 Antibody (2E5) [H00056287-M01] - Analysis of GKN1 expression in transfected 293T cell line by GKN1 monoclonal antibody (M01), clone 2E5.Lane 1: GKN1 transfected lysate(20 KDa).Lane 2: ...read more
Sandwich ELISA: Gastrokine 1 Antibody (2E5) [H00056287-M01] - Detection limit for recombinant GST tagged GKN1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Gastrokine 1 Antibody (2E5) Summary

Immunogen
GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Specificity
GKN1 - gastrokine 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GKN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using H00056287-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Gastrokine 1 Antibody (2E5)

  • 18 kDa antrum mucosa protein
  • AMP18
  • AMP-18
  • AMP18BRICHOS domain containing 1
  • BRICD1
  • CA11
  • CA11MGC70354
  • FOV
  • Foveolin
  • Gastrokine 1
  • gastrokine-1
  • GKN1
  • Protein CA11

Background

The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01863
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20619
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31688
Species: Hu
Applications: IHC, IHC-P
NBP2-26116
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-32005
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
DTFP10
Species: Hu
NBP2-31586
Species: Hu
Applications: IHC, IHC-P
AF2187
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-2564
Species: Hu
Applications: WB
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Gastrokine 1 Antibody (H00056287-M01)(6)

Reviews for Gastrokine 1 Antibody (H00056287-M01) (0)

There are no reviews for Gastrokine 1 Antibody (H00056287-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Gastrokine 1 Antibody (H00056287-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Gastrokine 1 Products

Bioinformatics Tool for Gastrokine 1 Antibody (H00056287-M01)

Discover related pathways, diseases and genes to Gastrokine 1 Antibody (H00056287-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gastrokine 1 Antibody (H00056287-M01)

Discover more about diseases related to Gastrokine 1 Antibody (H00056287-M01).
 

Pathways for Gastrokine 1 Antibody (H00056287-M01)

View related products by pathway.

PTMs for Gastrokine 1 Antibody (H00056287-M01)

Learn more about PTMs related to Gastrokine 1 Antibody (H00056287-M01).
 

Research Areas for Gastrokine 1 Antibody (H00056287-M01)

Find related products by research area.

Blogs on Gastrokine 1

There are no specific blogs for Gastrokine 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gastrokine 1 Antibody (2E5) and receive a gift card or discount.

Bioinformatics

Gene Symbol GKN1
Entrez
OMIM
Uniprot