Gastrokine 1 Antibody (2E5) - Azide and BSA Free Summary
Immunogen |
GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN |
Specificity |
GKN1 - gastrokine 1 |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
GKN1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
Publications |
|
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Gastrokine 1 Antibody (2E5) - Azide and BSA Free
Background
The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, mIF, WB
Species: Hu
Applications: WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for Gastrokine 1 Antibody (H00056287-M01)(9)
Showing Publications 1 -
9 of 9.
Publications using H00056287-M01 |
Applications |
Species |
Alarcon-Millan J, Lorenzo-Nazario S, Jimenez-Wences H et al. Women with chronic follicular gastritis positive for Helicobacter pylori express lower levels of GKN1. Gastric Cancer. 2020-02-21 [PMID: 32086651] |
|
|
Stella C, Faraonio R, Federico A et al. GKN1 expression in gastric cancer cells is negatively regulated by miR-544a. Biochimie. 2019-09-08 [PMID: 31509760] |
|
|
Villano V, Di Stadio CS, Federico A et al. Gastrokine 1 mRNA in human sera is not informative biomarker for gastric cancer. J Negat Results Biomed 2016-07-25 [PMID: 27452910] |
|
|
Altieri F, Di Stadio CS, Severino V et al. Anti-amyloidogenic property of human gastrokine 1. Biochimie. 2014-08-17 [PMID: 25139219] |
|
|
Mao W, Chen J, Peng TL et al. Helicobacter pylori infection and administration of non-steroidal anti-inflammatory drugs down-regulate the expression of gastrokine-1 in gastric mucosa. Turk J Gastroenterol. 2012-06-01 [PMID: 22798109] |
|
|
Mao W, Chen J, Peng TL et al. Downregulation of gastrokine-1 in gastric cancer tissues and restoration of its expression induced gastric cancer cells to apoptosis. J Exp Clin Cancer Res. 2012-05-23 [PMID: 22621392] |
|
|
Kam SY, Hennessy T, Chua SC et al. Characterization of the Human Gastric Fluid Proteome Reveals Distinct pH-Dependent Protein Profiles: Implications for Biomarker Studies. J Proteome Res. 2011-08-15 [PMID: 21842849] |
|
|
Rippa E, La Monica G, Allocca R et Al. Overexpression of gastrokine 1 in gastric cancer cells induces Fas-mediated apoptosis J Cell Physiol 2011-10-13 [PMID: 21792914] |
|
|
Rippa E, La Monica G, Allocca R et al. Overexpression of gastrokine 1 in gastric cancer cells induces fas-mediated apoptosis. J Cell Physiol. 2010-12-28 [PMID: 21190249] |
|
|
Reviews for Gastrokine 1 Antibody (H00056287-M01) (0)
There are no reviews for Gastrokine 1 Antibody (H00056287-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Gastrokine 1 Antibody (H00056287-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Gastrokine 1 Products
Research Areas for Gastrokine 1 Antibody (H00056287-M01)
Find related products by research area.
|
Blogs on Gastrokine 1