Recombinant Human Gastric Lipase Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Gastric Lipase Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 299-398 of Human LIPF partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
LIPF
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Gastric Lipase Protein

  • EC 3.1.1
  • EC 3.1.1.3
  • Gastric lipase
  • gastric triacylglycerol lipase
  • GL
  • HGL
  • HLAL
  • lipase, gastric
  • MGC138477
  • MGC142271

Background

LIPF - lipase, gastric

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52926
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-59934
Species: Hu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Gastric Lipase Partial Recombinant Protein (H00008513-Q01) (0)

There are no publications for Gastric Lipase Partial Recombinant Protein (H00008513-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gastric Lipase Partial Recombinant Protein (H00008513-Q01) (0)

There are no reviews for Gastric Lipase Partial Recombinant Protein (H00008513-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gastric Lipase Partial Recombinant Protein (H00008513-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gastric Lipase Products

Bioinformatics Tool for Gastric Lipase Partial Recombinant Protein (H00008513-Q01)

Discover related pathways, diseases and genes to Gastric Lipase Partial Recombinant Protein (H00008513-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gastric Lipase Partial Recombinant Protein (H00008513-Q01)

Discover more about diseases related to Gastric Lipase Partial Recombinant Protein (H00008513-Q01).
 

Pathways for Gastric Lipase Partial Recombinant Protein (H00008513-Q01)

View related products by pathway.

PTMs for Gastric Lipase Partial Recombinant Protein (H00008513-Q01)

Learn more about PTMs related to Gastric Lipase Partial Recombinant Protein (H00008513-Q01).
 

Research Areas for Gastric Lipase Partial Recombinant Protein (H00008513-Q01)

Find related products by research area.

Blogs on Gastric Lipase

There are no specific blogs for Gastric Lipase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Gastric Lipase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LIPF