gamma Catenin Antibody (9O2K8)

Western Blot: gamma Catenin Antibody (9O2K8) [NBP3-16344] - Western blot analysis of extracts of various cell lines, using gamma Catenin Rabbit mAb (NBP3-16344) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Western Blot: gamma Catenin Antibody (9O2K8) [NBP3-16344] - Western blot analysis of extracts of Rat heart, using gamma Catenin Rabbit mAb (NBP3-16344) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/ Immunofluorescence: gamma Catenin Antibody (9O2K8) [NBP3-16344] - Immunofluorescence analysis of HeLa cells using gamma Catenin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: gamma Catenin Antibody (9O2K8) [NBP3-16344] - Immunofluorescence analysis of NIH-3T3 cells using gamma Catenin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 9O2K8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

gamma Catenin Antibody (9O2K8) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 15-115 of human gamma Catenin (P14923). EWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQR
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: JUP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for gamma Catenin Antibody (9O2K8)

• catenin (cadherin-associated protein), gamma (80kD)
• catenin (cadherin-associated protein), gamma 80kDa
• Catenin gamma
• Desmoplakin III
• desmoplakin-3
• DP3CTNNG
• DPIII
• gamma-catenin
• junction plakoglobin
• PDGBARVD12
• PKGB

Background

Catenin gamma, also known as Junction Plakoglobin, is a common junctional plaque protein. It is a cytoplasmic protein with soluble and membrane-associated forms. The presence of Catenin gamma in both the desmosomes and in the intermediate junctions suggests it has a role in the structure and Function of submembranous plaques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JUP