gamma C Crystallin Antibody (7C4)

Images

 
Western Blot: gamma C Crystallin Antibody (7C4) [H00001420-M01C] - Detection against Immunogen (36.74 KDa)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
7C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

gamma C Crystallin Antibody (7C4) Summary

Immunogen
CRYGC (NP_066269 75 a.a. - 174 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY
Specificity
CRYGC - crystallin, gamma C (7C4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRYGC
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for gamma C Crystallin Antibody (7C4)

  • CCL
  • CRYG3gamma-C-crystallin
  • crystallin, gamma C
  • crystallin, gamma-3
  • Gamma-C-crystallin
  • Gamma-crystallin 2-1
  • Gamma-crystallin 3
  • gamma-crystallin C

Background

Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-68641
Species: Hu
Applications: ICC/IF
366-6C/CF
Species: Hu
NBP2-46354
Species: Hu
Applications: WB, IHC, IF
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP2-58258
Species: Hu
Applications: WB, ICC/IF
NB100-2519
Species: Hu, Mu
Applications: WB, ICC/IF
H00001420-M01C
Species: Hu
Applications: WB, ELISA

Publications for gamma C Crystallin Antibody (H00001420-M01C) (0)

There are no publications for gamma C Crystallin Antibody (H00001420-M01C).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gamma C Crystallin Antibody (H00001420-M01C) (0)

There are no reviews for gamma C Crystallin Antibody (H00001420-M01C). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for gamma C Crystallin Antibody (H00001420-M01C) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for gamma C Crystallin Antibody (H00001420-M01C)

Discover related pathways, diseases and genes to gamma C Crystallin Antibody (H00001420-M01C). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gamma C Crystallin Antibody (H00001420-M01C)

Discover more about diseases related to gamma C Crystallin Antibody (H00001420-M01C).
 

Pathways for gamma C Crystallin Antibody (H00001420-M01C)

View related products by pathway.

Research Areas for gamma C Crystallin Antibody (H00001420-M01C)

Find related products by research area.

Blogs on gamma C Crystallin

There are no specific blogs for gamma C Crystallin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gamma C Crystallin Antibody (7C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYGC
Entrez
Uniprot