Galectin-3 Antibody - BSA Free

Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol.

Analysis in human cell line RT-4.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Galectin-3 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Galectin-3 using the following amino acid sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAY
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LGALS3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Galectin-3 Antibody - BSA Free

• AGE-R3
• Carbohydrate-binding protein 35
• CBP 35,35 kDa lectin
• CBP35
• GAL3
• Gal-3
• galactin-3
• Galactose-specific lectin 3
• Galactoside-binding protein
• GALBPCBP35
• Galectin3
• Galectin-3
• GALIG
• IgE-binding protein
• L29
• L31
• L-31
• Laminin-binding protein
• Lectin L-29
• lectin, galactoside-binding, soluble, 3
• LGALS2
• LGALS3
• Mac-2 antigen
• Mac-2
• MAC2GAL3

Background

Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LGALS3