Galectin-3 Antibody

Images

 
Western Blot: Galectin-3 Antibody [NBP1-89795] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: Galectin-3 Antibody [NBP1-89795] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Galectin-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LGALS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Galectin-3 Protein (NBP1-89795PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Galectin-3 Antibody

  • AGE-R3
  • Carbohydrate-binding protein 35
  • CBP 35,35 kDa lectin
  • CBP35
  • GAL3
  • Gal-3
  • galactin-3
  • Galactose-specific lectin 3
  • Galactoside-binding protein
  • GALBPCBP35
  • Galectin3
  • Galectin-3
  • GALIG
  • IgE-binding protein
  • L29
  • L31
  • L-31
  • Laminin-binding protein
  • Lectin L-29
  • lectin, galactoside-binding, soluble, 3
  • LGALS2
  • LGALS3
  • Mac-2 antigen
  • Mac-2
  • MAC2GAL3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-53210
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PAGE
AF1339
Species: Hu
Applications: WB, Simple Western, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF482
Species: Mu
Applications: WB, IHC
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2226
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Galectin-3 Antibody (NBP1-89795) (0)

There are no publications for Galectin-3 Antibody (NBP1-89795).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-3 Antibody (NBP1-89795) (0)

There are no reviews for Galectin-3 Antibody (NBP1-89795). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Galectin-3 Antibody (NBP1-89795) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Galectin-3 Products

Bioinformatics Tool for Galectin-3 Antibody (NBP1-89795)

Discover related pathways, diseases and genes to Galectin-3 Antibody (NBP1-89795). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Galectin-3 Antibody (NBP1-89795)

Discover more about diseases related to Galectin-3 Antibody (NBP1-89795).
 

Pathways for Galectin-3 Antibody (NBP1-89795)

View related products by pathway.

PTMs for Galectin-3 Antibody (NBP1-89795)

Learn more about PTMs related to Galectin-3 Antibody (NBP1-89795).
 

Research Areas for Galectin-3 Antibody (NBP1-89795)

Find related products by research area.

Blogs on Galectin-3

There are no specific blogs for Galectin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Galectin-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LGALS3
Entrez