GABPA Antibody

Product Discontinued

GABPA Antibody Summary

• Immunogen: Synthetic peptide derived from residues 360-414 of Human GABPA. (Note: the amino acid sequence is proprietary). Peptide sequence KWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIG.
• Localization: Nuclear
• Specificity: NB100-2050 reacts with GA Binding Protein a chain (GABPA).
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (100%), Bovine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GABPA
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:100-1:2000
• Application Notes: This antibody can be used in Immunohistochemistry (paraffin sections). IHC-P: 4-8 ug/ml *Optimal dilutions should be determined by the end user.
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control:

  Jurkat Whole Cell Lysate
  Human Kidney Whole Tissue Lysate (Adult Whole Normal)
  GABPA Overexpression Lysate

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GABPA Antibody

• E4TF1-60
• E4TF1ATranscription factor E4TF1-60
• GA binding protein transcription factor, alpha subunit 60kDa
• GA-binding protein alpha chain
• GA-binding protein transcription factor, alpha subunit (60kD)
• GABP subunit alpha
• human nuclear respiratory factor-2 subunit alpha, 10
• NFT2
• NRF2
• NRF2A
• nuclear respiratory factor 2 alpha subunit
• Nuclear respiratory factor 2 subunit alpha

Background

GA Binding Protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GABPA
• Entrez:
  • 2551(Human)