GABA-A R gamma 3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit GABA-A R gamma 3 Antibody - BSA Free (NBP2-84948) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GABA-A R gamma 3. Peptide sequence: LHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDKKLRP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GABRG3 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for GABA-A R gamma 3 Antibody - BSA Free
Background
GABAA receptor, subunit gamma 3, is the ligand-gated ion channel through which GABAA (gamma-aminobutyric acid) exerts its inhibitory neurotransmitter function.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA
Species: Hu, Tr
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bt, Bv, Ca, Gp, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: WB
Publications for GABA-A R gamma 3 Antibody (NBP2-84948) (0)
There are no publications for GABA-A R gamma 3 Antibody (NBP2-84948).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GABA-A R gamma 3 Antibody (NBP2-84948) (0)
There are no reviews for GABA-A R gamma 3 Antibody (NBP2-84948).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GABA-A R gamma 3 Antibody (NBP2-84948) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GABA-A R gamma 3 Products
Research Areas for GABA-A R gamma 3 Antibody (NBP2-84948)
Find related products by research area.
|
Blogs on GABA-A R gamma 3