GABA-A R gamma 3 Antibody

Images

 
There are currently no images for GABA-A R gamma 3 Antibody (NBP2-84948).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GABA-A R gamma 3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GABA-A R gamma 3. Peptide sequence: LHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDKKLRP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GABRG3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for GABA-A R gamma 3 Antibody

  • GABA A R gamma 3
  • GABA(A) receptor subunit gamma-3
  • GABAAR gamma 3
  • GABAARg3
  • GABRG3
  • gamma-aminobutyric acid (GABA) A receptor, gamma 3
  • gamma-aminobutyric acid receptor subunit gamma-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-199
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-75497
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007337-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD
NBP2-59325
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1101
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-76347
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA
NBP1-91003
Species: Hu, Tr
Applications: IHC, IHC-P
NB300-190
Species: Hu, Mu, Rt
Applications: WB, IHC, KD
NBP2-21598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NLS1331
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Gp, Ha, Pm, Pm, Rb, Sh
Applications: IHC, IHC-P
NB100-56511
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
NBP1-62583
Species: Hu
Applications: WB
AF5158
Species: Hu
Applications: WB, IHC
NB600-1081
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB110-60019
Species: Mu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC
NBP2-84948
Species: Hu
Applications: WB

Publications for GABA-A R gamma 3 Antibody (NBP2-84948) (0)

There are no publications for GABA-A R gamma 3 Antibody (NBP2-84948).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-A R gamma 3 Antibody (NBP2-84948) (0)

There are no reviews for GABA-A R gamma 3 Antibody (NBP2-84948). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GABA-A R gamma 3 Antibody (NBP2-84948) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GABA-A R gamma 3 Products

Bioinformatics Tool for GABA-A R gamma 3 Antibody (NBP2-84948)

Discover related pathways, diseases and genes to GABA-A R gamma 3 Antibody (NBP2-84948). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA-A R gamma 3 Antibody (NBP2-84948)

Discover more about diseases related to GABA-A R gamma 3 Antibody (NBP2-84948).
 

Pathways for GABA-A R gamma 3 Antibody (NBP2-84948)

View related products by pathway.

PTMs for GABA-A R gamma 3 Antibody (NBP2-84948)

Learn more about PTMs related to GABA-A R gamma 3 Antibody (NBP2-84948).

Blogs on GABA-A R gamma 3

There are no specific blogs for GABA-A R gamma 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABA-A R gamma 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABRG3