GABA-A R gamma 1 Antibody

Images

 
Immunohistochemistry-Paraffin: GABA-A R gamma 1 Antibody [NBP1-91003] - Staining of human Skin shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: GABA-A R gamma 1 Antibody [NBP1-91003] - Staining of human Cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: GABA-A R gamma 1 Antibody [NBP1-91003] - Staining of human Cerebral cortex shows strong membranous and cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: GABA-A R gamma 1 Antibody [NBP1-91003] - Staining of human Tonsil shows no positivity in non-germinal center cells as expected.

Product Details

Summary
Reactivity Hu, Tr, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GABA-A R gamma 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQIL
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABRG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GABA-A R gamma 1 Protein (NBP1-91003PEP)
Publications
Read Publications using
NBP1-91003 in the following applications:

Reactivity Notes

Turkey reactivity reported in scientific literature (PMID: 27055929).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GABA-A R gamma 1 Antibody

  • DKFZp686H2042
  • GABA A R gamma 1
  • GABA(A) receptor subunit gamma-1
  • GABAAR gamma 1
  • GABAARg1
  • GABRG1
  • Gamma-1 Polypeptide
  • gamma-aminobutyric acid (GABA) A receptor, gamma 1
  • gamma-aminobutyric acid receptor subunit gamma-1
  • MGC33838

Background

GABA A Receptor gamma 1 is encoded by this gene belongs to the ligand-gated ionic channel family. It is an integral membrane protein and plays an important role in inhibiting neurotransmission by binding to the benzodiazepine receptor and opening an integral chloride channel. This gene is clustered with three other family members on chromosome 4. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GABA-A R gamma 1 Antibody (NBP1-91003)(2)

We have publications tested in 1 confirmed species: Turkey.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Turkey
(1)
All Species

Reviews for GABA-A R gamma 1 Antibody (NBP1-91003) (0)

There are no reviews for GABA-A R gamma 1 Antibody (NBP1-91003). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GABA-A R gamma 1 Antibody (NBP1-91003) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GABA-A R gamma 1 Products

Research Areas for GABA-A R gamma 1 Antibody (NBP1-91003)

Find related products by research area.

Blogs on GABA-A R gamma 1

There are no specific blogs for GABA-A R gamma 1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABA-A R gamma 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABRG1