GABA-A R gamma 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GABA-A R gamma 1 Antibody [NBP1-91003] - Staining of human Skin shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: GABA-A R gamma 1 Antibody [NBP1-91003] - Staining of human Cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: GABA-A R gamma 1 Antibody [NBP1-91003] - Staining of human Cerebral cortex shows strong membranous and cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: GABA-A R gamma 1 Antibody [NBP1-91003] - Staining of human Tonsil shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu, Tr, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GABA-A R gamma 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQIL
• Predicted Species: Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GABRG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GABA-A R gamma 1 Protein (NBP1-91003PEP)

Reactivity Notes

Turkey reactivity reported in scientific literature (PMID: 27055929).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GABA-A R gamma 1 Antibody - BSA Free

• DKFZp686H2042
• GABA A R gamma 1
• GABA(A) receptor subunit gamma-1
• GABAAR gamma 1
• GABAARg1
• GABRG1
• Gamma-1 Polypeptide
• gamma-aminobutyric acid (GABA) A receptor, gamma 1
• gamma-aminobutyric acid receptor subunit gamma-1
• MGC33838

Background

GABA A Receptor gamma 1 is encoded by this gene belongs to the ligand-gated ionic channel family. It is an integral membrane protein and plays an important role in inhibiting neurotransmission by binding to the benzodiazepine receptor and opening an integral chloride channel. This gene is clustered with three other family members on chromosome 4. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GABA-A R gamma 1 Antibody (NBP1-91003)(2)

Publications using NBP1-91003

• Kosonsiriluk S, Chaiworakul V, Mauro LJ, El Halawani ME. Enhanced GABAergic inhibition in the premammillary nucleus of photorefractory turkey hens via GABAA receptor upregulation. Gen. Comp. Endocrinol. 2016-04-04 [PMID: 27055929] (IF/IHC, Turkey)
• Smits A, Jin Z, Elsir T et al. GABA-A channel subunit expression in human glioma correlates with tumor histology and clinical outcome. PLoS One 2012-01-01 [PMID: 22615883]

Bioinformatics

• Gene Symbol: GABRG1