GABA-A R beta 3 Antibody - BSA Free

Western Blot: GABA-A R beta 3 Antibody [NBP3-10363] - Western blot analysis using NBP3-10363 on Human Liver as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GABA-A R beta 3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GABA-A R beta 3 (NP_068712). Peptide sequence ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GABRB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 52 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GABA-A R beta 3 Antibody - BSA Free

• ECA5
• GABA A R beta 3
• GABA(A) receptor beta-3 subunit
• GABA(A) receptor subunit beta-3
• GABAA receptor beta-3 subunit
• GABA-alpha receptor beta-2 subunit
• GABAAR beta 3
• GABAARb3
• GABRB3
• gamma-aminobutyric acid (GABA) A receptor, beta 3
• gamma-aminobutyric acid receptor subunit beta-3
• MGC9051

Background

The GABRB3 gene encodes a member of the ligand-gated ionic channel family. The encoded protein, GABA A Receptor beta 3, is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. GABRB3 is located on the long arm of chromosome 15 in a cluster with two genes encoding related subunits of the family. Mutations in the GABA A Receptor beta 3 gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GABRB3