GABA-A R beta 3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit GABA-A R beta 3 Antibody - BSA Free (NBP3-10363) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GABA-A R beta 3 (NP_068712). Peptide sequence ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GABRB3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Western Blot 1.0 ug/ml
|
| Theoretical MW |
52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for GABA-A R beta 3 Antibody - BSA Free
Background
The GABRB3 gene encodes a member of the ligand-gated ionic channel family. The encoded protein, GABA A Receptor beta 3, is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. GABRB3 is located on the long arm of chromosome 15 in a cluster with two genes encoding related subunits of the family. Mutations in the GABA A Receptor beta 3 gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, KD, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, MiAr, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: WB, IHC
Publications for GABA-A R beta 3 Antibody (NBP3-10363) (0)
There are no publications for GABA-A R beta 3 Antibody (NBP3-10363).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GABA-A R beta 3 Antibody (NBP3-10363) (0)
There are no reviews for GABA-A R beta 3 Antibody (NBP3-10363).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GABA-A R beta 3 Antibody (NBP3-10363) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GABA-A R beta 3 Products
Research Areas for GABA-A R beta 3 Antibody (NBP3-10363)
Find related products by research area.
|
Blogs on GABA-A R beta 3