GABA-A R beta 1 Antibody

Images

 
Immunohistochemistry-Paraffin: GABA-A R beta 1 Antibody [NBP2-14034] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GABA-A R beta 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABRB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GABA-A R beta 1 Protein (NBP2-14034PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GABA-A R beta 1 Antibody

  • GABA A R beta 1
  • GABA(A) receptor subunit beta-1
  • GABAAR beta 1
  • GABAARb1
  • GABRB1
  • gamma-aminobutyric acid (GABA) A receptor, beta 1
  • gamma-aminobutyric acid receptor subunit beta-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPS025
Species: Hu, Mu, Rt, Bv, Ca, Pm, Ze
Applications: WB
NB300-199
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IF, IHC-FrFl
NBP2-36560
Species: Mu, Rt
Applications: WB, IHC
NB300-198
Species: Mu, Rt
Applications: WB
NB300-195
Species: Mu, Rt
Applications: WB, IHC
NBP1-91003
Species: Hu, Tr
Applications: IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NB300-191
Species: Hu, Mu, Rt
Applications: WB
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
1705-HH/CF
Species: Hu, Mu
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2796
Species: Hu
Applications: WB, IHC
H00006532-M06
Species: Hu
Applications: ELISA, IP
AF1062
Species: Mu
Applications: WB, IHC, Neut
H00001815-R02
Species: Hu
NB300-196
Species: Mu, Rt
Applications: WB, ICC/IF
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE

Publications for GABA-A R beta 1 Antibody (NBP2-14034) (0)

There are no publications for GABA-A R beta 1 Antibody (NBP2-14034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-A R beta 1 Antibody (NBP2-14034) (0)

There are no reviews for GABA-A R beta 1 Antibody (NBP2-14034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GABA-A R beta 1 Antibody (NBP2-14034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GABA-A R beta 1 Products

Bioinformatics Tool for GABA-A R beta 1 Antibody (NBP2-14034)

Discover related pathways, diseases and genes to GABA-A R beta 1 Antibody (NBP2-14034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA-A R beta 1 Antibody (NBP2-14034)

Discover more about diseases related to GABA-A R beta 1 Antibody (NBP2-14034).
 

Pathways for GABA-A R beta 1 Antibody (NBP2-14034)

View related products by pathway.

Research Areas for GABA-A R beta 1 Antibody (NBP2-14034)

Find related products by research area.

Blogs on GABA-A R beta 1

There are no specific blogs for GABA-A R beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABA-A R beta 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABRB1
Entrez