GABA-A R beta 1 Antibody


Immunohistochemistry-Paraffin: GABA-A R beta 1 Antibody [NBP2-14034] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

GABA-A R beta 1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI
Specificity of human GABA-A R beta 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GABA-A R beta 1 Protein (NBP2-14034PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GABA-A R beta 1 Antibody

  • GABA A R beta 1
  • GABA(A) receptor subunit beta-1
  • GABAAR beta 1
  • GABAARb1
  • GABRB1
  • gamma-aminobutyric acid (GABA) A receptor, beta 1
  • gamma-aminobutyric acid receptor subunit beta-1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IF, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Mu, Rt
Applications: WB
Species: Mu, Rt
Applications: WB, IHC
Species: Hu, Tr
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: WB, IHC, Neut
Species: Hu, Mk, Pm
Applications: IHC-P
Species: Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GABA-A R beta 1 Antibody (NBP2-14034) (0)

There are no publications for GABA-A R beta 1 Antibody (NBP2-14034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-A R beta 1 Antibody (NBP2-14034) (0)

There are no reviews for GABA-A R beta 1 Antibody (NBP2-14034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GABA-A R beta 1 Antibody (NBP2-14034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GABA-A R beta 1 Products

Bioinformatics Tool for GABA-A R beta 1 Antibody (NBP2-14034)

Discover related pathways, diseases and genes to GABA-A R beta 1 Antibody (NBP2-14034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA-A R beta 1 Antibody (NBP2-14034)

Discover more about diseases related to GABA-A R beta 1 Antibody (NBP2-14034).

Pathways for GABA-A R beta 1 Antibody (NBP2-14034)

View related products by pathway.

Research Areas for GABA-A R beta 1 Antibody (NBP2-14034)

Find related products by research area.

Blogs on GABA-A R beta 1

There are no specific blogs for GABA-A R beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GABA-A R beta 1 Antibody and receive a gift card or discount.


Gene Symbol GABRB1