G2A/GPR132 Recombinant Protein Antigen

Images

 
There are currently no images for G2A/GPR132 Protein (NBP1-89808PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

G2A/GPR132 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR132.

Source: E. coli

Amino Acid Sequence: HSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPR132
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89808.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for G2A/GPR132 Recombinant Protein Antigen

  • G protein-coupled receptor 132
  • G2 accumulation protein
  • G2A
  • G2AG protein-coupled receptor G2A
  • GPR132
  • MGC99642
  • probable G-protein coupled receptor 132

Background

GPR132, also known as G2A (for G2 accumulation), is a seven transmembrane G protein-coupled receptor that is upregulated in response to DNA damage and stress. G2A is predominantly expressed in hematopoietic tissues and in hematopoietic stem cells, and it is more highly detected in pro-B cells, while lower expression is observed in immature B cells and pre-B cells. G2A is expressed throughout T cell maturation, and it is further increased in response to T-cell activation. Ectopic expression of a G2A fusion protein in NIH/3T3 fibroblasts induces a cell cycle arrest that is consistent with a block at the G2/M transition. G2A is also able to attenuate the proliferative effects of Bcr-Abl, a chimeric tyrosine kinase oncogene, suggesting that G2A possesses anti-oncogenic properties. The amino acid sequence of G2A contains a destruction box motif that is consistently observed in cyclins, where it is required for ubiquitination and proteolytic degradation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

6507-IL/CF
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
202-IL
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
7268-CT
Species: Hu
Applications: BA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
2984-SE
Species: Hu
Applications: EnzAct
NLS1194
Species: Bv, Eq, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: IHC,  IHC-P
NLS145
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P
NBP3-21356
Species: Hu
Applications: IHC,  IHC-P, WB
M5000
Species: Mu
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-89808PEP
Species: Hu
Applications: AC

Publications for G2A/GPR132 Protein (NBP1-89808PEP) (0)

There are no publications for G2A/GPR132 Protein (NBP1-89808PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G2A/GPR132 Protein (NBP1-89808PEP) (0)

There are no reviews for G2A/GPR132 Protein (NBP1-89808PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for G2A/GPR132 Protein (NBP1-89808PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional G2A/GPR132 Products

Research Areas for G2A/GPR132 Protein (NBP1-89808PEP)

Find related products by research area.

Blogs on G2A/GPR132

There are no specific blogs for G2A/GPR132, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our G2A/GPR132 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR132