G protein alpha Inhibitor 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: G protein alpha Inhibitor 2 Antibody [NBP1-89771] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: G protein alpha Inhibitor 2 Antibody [NBP1-89771] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: G protein alpha Inhibitor 2 Antibody [NBP1-89771] - Staining of human fallopian tube shows strong membranous(cilia) positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

G protein alpha Inhibitor 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNAI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
G protein alpha Inhibitor 2 Protein (NBP1-89771PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for G protein alpha Inhibitor 2 Antibody

  • alpha-2 subunit
  • guanine nucleotide binding protein (G protein), alpha inhibiting activitypolypeptide 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-48988
Species: Hu
Applications: IHC
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
MAB8210
Species: Hu
Applications: Flow, IHC, Block, CyTOF-ready
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-49600
Species: Hu
Applications: IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-89771
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for G protein alpha Inhibitor 2 Antibody (NBP1-89771) (0)

There are no publications for G protein alpha Inhibitor 2 Antibody (NBP1-89771).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G protein alpha Inhibitor 2 Antibody (NBP1-89771) (0)

There are no reviews for G protein alpha Inhibitor 2 Antibody (NBP1-89771). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for G protein alpha Inhibitor 2 Antibody (NBP1-89771) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G protein alpha Inhibitor 2 Products

Bioinformatics Tool for G protein alpha Inhibitor 2 Antibody (NBP1-89771)

Discover related pathways, diseases and genes to G protein alpha Inhibitor 2 Antibody (NBP1-89771). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G protein alpha Inhibitor 2 Antibody (NBP1-89771)

Discover more about diseases related to G protein alpha Inhibitor 2 Antibody (NBP1-89771).
 

Pathways for G protein alpha Inhibitor 2 Antibody (NBP1-89771)

View related products by pathway.

PTMs for G protein alpha Inhibitor 2 Antibody (NBP1-89771)

Learn more about PTMs related to G protein alpha Inhibitor 2 Antibody (NBP1-89771).
 

Research Areas for G protein alpha Inhibitor 2 Antibody (NBP1-89771)

Find related products by research area.

Blogs on G protein alpha Inhibitor 2

There are no specific blogs for G protein alpha Inhibitor 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G protein alpha Inhibitor 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNAI2