Novus Biologicals products are now on bio-techne.com

G protein alpha Inhibitor 2 Antibody

Images

 
Western Blot: G protein alpha Inhibitor 2 Antibody [NBP1-58301] - Sample Type: Nthy-ori cell lysate (50ug) Primary Dilution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:2000
Western Blot: G protein alpha Inhibitor 2 Antibody [NBP1-58301] - GNAI2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Lung

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

G protein alpha Inhibitor 2 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to GNAI2(guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2) The peptide sequence was selected from the C terminal of GNAI2 (NP_002061). Peptide sequence EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: alpha-2.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNAI2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-58301.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for G protein alpha Inhibitor 2 Antibody

  • alpha-2 subunit
  • guanine nucleotide binding protein (G protein), alpha inhibiting activitypolypeptide 2

Background

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-46349
Species: Hu
Applications: IHC, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-48988
Species: Hu
Applications: IHC, IHC-P
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
MAB8210
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-97308
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-93868
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03282
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-58301
Species: Hu, Mu
Applications: WB

Publications for G protein alpha Inhibitor 2 Antibody (NBP1-58301)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-58301 Applications Species
Bushfield,M. J. Cell. Sci. 120 (PT 13), 2171-2178. 2007-01-01 [PMID: 17550964]

Reviews for G protein alpha Inhibitor 2 Antibody (NBP1-58301) (0)

There are no reviews for G protein alpha Inhibitor 2 Antibody (NBP1-58301). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G protein alpha Inhibitor 2 Antibody (NBP1-58301) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G protein alpha Inhibitor 2 Products

Research Areas for G protein alpha Inhibitor 2 Antibody (NBP1-58301)

Find related products by research area.

Blogs on G protein alpha Inhibitor 2

There are no specific blogs for G protein alpha Inhibitor 2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G protein alpha Inhibitor 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNAI2
Entrez
Uniprot