Fyn Antibody

Images

 
Western Blot: Fyn Antibody [NBP2-57212] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Fyn Antibody [NBP2-57212] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fyn Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE
Specificity
Specificity of human Fyn antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FYN
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Fyn Lysate (NBP2-65529)
Control Peptide
Fyn Recombinant Protein Antigen (NBP2-57212PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Fyn Antibody

  • EC 2.7.10
  • EC 2.7.10.2
  • FYN oncogene related to SRC, FGR, YES
  • Fyn
  • MGC45350
  • OKT3-induced calcium influx regulator
  • p59-Fyn
  • protein-tyrosine kinase fyn
  • Proto-oncogene c-Fyn
  • Proto-oncogene Syn
  • proto-oncogene tyrosine-protein kinase fyn
  • SLK
  • SLKc-syn protooncogene
  • src/yes-related novel
  • Src-like kinase
  • SYN
  • tyrosine kinase p59fyn(T)
  • tyrosine-protein kinase Fyn

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-85804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3206
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-85951
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB32051
Species: Hu, Mu, Rt
Applications: WB, IHC
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
NBP2-57212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for Fyn Antibody (NBP2-57212) (0)

There are no publications for Fyn Antibody (NBP2-57212).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fyn Antibody (NBP2-57212) (0)

There are no reviews for Fyn Antibody (NBP2-57212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Fyn Antibody (NBP2-57212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Fyn Antibody (NBP2-57212)

Discover related pathways, diseases and genes to Fyn Antibody (NBP2-57212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fyn Antibody (NBP2-57212)

Discover more about diseases related to Fyn Antibody (NBP2-57212).
 

Pathways for Fyn Antibody (NBP2-57212)

View related products by pathway.

PTMs for Fyn Antibody (NBP2-57212)

Learn more about PTMs related to Fyn Antibody (NBP2-57212).
 

Research Areas for Fyn Antibody (NBP2-57212)

Find related products by research area.

Blogs on Fyn

There are no specific blogs for Fyn, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fyn Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FYN
Entrez