Fyn Antibody


Western Blot: Fyn Antibody [NBP2-57212] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Fyn Antibody [NBP2-57212] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

Fyn Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE
Specificity of human Fyn antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Fyn Lysate (NBP2-65529)
Control Peptide
Fyn Recombinant Protein Antigen (NBP2-57212PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Fyn Antibody

  • EC 2.7.10
  • EC
  • FYN oncogene related to SRC, FGR, YES
  • Fyn
  • MGC45350
  • OKT3-induced calcium influx regulator
  • p59-Fyn
  • protein-tyrosine kinase fyn
  • Proto-oncogene c-Fyn
  • Proto-oncogene Syn
  • proto-oncogene tyrosine-protein kinase fyn
  • SLK
  • SLKc-syn protooncogene
  • src/yes-related novel
  • Src-like kinase
  • SYN
  • tyrosine kinase p59fyn(T)
  • tyrosine-protein kinase Fyn


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Fe, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for Fyn Antibody (NBP2-57212) (0)

There are no publications for Fyn Antibody (NBP2-57212).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fyn Antibody (NBP2-57212) (0)

There are no reviews for Fyn Antibody (NBP2-57212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Fyn Antibody (NBP2-57212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Fyn Antibody (NBP2-57212)

Discover related pathways, diseases and genes to Fyn Antibody (NBP2-57212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fyn Antibody (NBP2-57212)

Discover more about diseases related to Fyn Antibody (NBP2-57212).

Pathways for Fyn Antibody (NBP2-57212)

View related products by pathway.

PTMs for Fyn Antibody (NBP2-57212)

Learn more about PTMs related to Fyn Antibody (NBP2-57212).

Research Areas for Fyn Antibody (NBP2-57212)

Find related products by research area.

Blogs on Fyn

There are no specific blogs for Fyn, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Fyn Antibody and receive a gift card or discount.


Gene Symbol FYN