FUBP3 Antibody - BSA Free

Western Blot: FUBP3 Antibody [NBP2-58466] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: FUBP3 Antibody [NBP2-58466] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.

Western Blot: FUBP3 Antibody [NBP2-58466] - Analysis in human cell line U-138MG.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FUBP3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQ
• Predicted Species: Mouse (100%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FUBP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FUBP3 Recombinant Protein Antigen (NBP2-58466PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FUBP3 Antibody - BSA Free

• far upstream element (FUSE) binding protein 3
• far upstream element-binding protein 3
• FBP3
• FLJ25229
• FUSE-binding protein 3

Background

Activation of FUSE, the far-upstream element, is required for the proper expression of the mammalian gene c-Myc in undifferentiated cells. The binding of FBP (FUSE-binding protein) to FUSE is necessary for c-Myc expression, indicating that FBP functions as a growth-dependent regulator of c-Myc expression. Isolated from proliferating HL60 cells, FBP, FBP2, and FBP3 comprise a family of single-stranded DNA-binding proteins that specifically bind to FUSE elements. The FBP transcription factors share a conserved central DNA-binding domain and show significant homology in their carboxylterminal activation domains. Expression of FBP is detected in undifferentiated cells and is substantially decreased following cellular differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FUBP3