FTSJD2 Antibody - BSA Free

Immunohistochemistry-Paraffin: FTSJD2 Antibody [NBP1-83046] - Staining in human testis and liver tissues using NBP1-83046 antibody. Corresponding CMTR1 RNA-seq data are presented for the same tissues.

Western Blot: FTSJD2 Antibody [NBP1-83046] - Analysis using Anti-CMTR1 antibody NBP1-83046 (A) shows similar pattern to independent antibody NBP1-83047 (B).

Immunocytochemistry/Immunofluorescence: FTSJD2 Antibody [NBP1-83046] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Western Blot: FTSJD2 Antibody [NBP1-83046] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: FTSJD2 Antibody [NBP1-83046] - Staining of human cerebellum shows moderate to strong nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: FTSJD2 Antibody [NBP1-83046] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: FTSJD2 Antibody [NBP1-83046] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: FTSJD2 Antibody [NBP1-83046] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FTSJD2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FTSJD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FTSJD2 Protein (NBP1-83046PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FTSJD2 Antibody - BSA Free

• Cap1 2'O-ribose methyltransferase 1
• cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
• EC 2.1.1.57
• FtsJ methyltransferase domain containing 2
• FtsJ methyltransferase domain-containing protein 2
• hMTr1
• Interferon-stimulated gene 95 kDa protein
• ISG95
• KIAA0082FLJ22156
• MTR1
• S-adenosyl-L-methionine-dependent methyltransferase FTSJD2

Background

KIAA0082 was first identified as a hypothetical protein predicted from the in silico analysis of long cDNAs isolated in the Kazusa cDNA sequencing project. KIAA0082 contains a G-patch and WW domain and several predicted phosphoserine sites.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FTSJD2