FTSJ1 Antibody


Western Blot: FTSJ1 Antibody [NBP1-52940] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FTSJ1 Antibody Summary

Synthetic peptides corresponding to FTSJ1(FtsJ homolog 1 (E. coli)) The peptide sequence was selected from the N terminal of FTSJ1. Peptide sequence MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FTSJ1 and was validated on Western blot.
Positive Control
FTSJ1 Lysate (NBP2-65810)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FTSJ1 Antibody

  • cell division protein
  • EC 2.1.1.-
  • FtsJ homolog 1 (E. coli)
  • JM23
  • mental retardation, X-linked 44
  • mental retardation, X-linked 9
  • MRX44
  • Protein ftsJ homolog 1
  • putative ribosomal RNA methyltransferase 1
  • rRNA (uridine-2'-O-)-methyltransferase
  • SPB1MRX9
  • TRM7


FTSJ1 is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA.The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for FTSJ1 Antibody (NBP1-52940) (0)

There are no publications for FTSJ1 Antibody (NBP1-52940).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FTSJ1 Antibody (NBP1-52940) (0)

There are no reviews for FTSJ1 Antibody (NBP1-52940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FTSJ1 Antibody (NBP1-52940) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional FTSJ1 Products

Bioinformatics Tool for FTSJ1 Antibody (NBP1-52940)

Discover related pathways, diseases and genes to FTSJ1 Antibody (NBP1-52940). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FTSJ1 Antibody (NBP1-52940)

Discover more about diseases related to FTSJ1 Antibody (NBP1-52940).

Pathways for FTSJ1 Antibody (NBP1-52940)

View related products by pathway.

PTMs for FTSJ1 Antibody (NBP1-52940)

Learn more about PTMs related to FTSJ1 Antibody (NBP1-52940).

Blogs on FTSJ1

There are no specific blogs for FTSJ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FTSJ1 Antibody and receive a gift card or discount.


Gene Symbol FTSJ1