FSH beta Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FSH beta. Source: E. coli Amino Acid Sequence: TRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
FSHB |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57723. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for FSH beta Recombinant Protein Antigen
Background
FSH is a pituitary hormone involved in the maturation of ovarian follicles and estrogen secretion in females. In the pituitary gland, FSH is produced by gonadotrophs. In males, FSH stimulates the secretion of testosterone. Follicle stimulating hormone enables ovarian folliculogenesis to the antral follicle stage and is essential for Sertoli cell proliferation and maintenance of sperm quality in the testis. Members of the pituitary glycoprotein hormone family, of which FSH is one (see also luteinizing hormone, chorionic gonadotropin, and thyroid stimulating hormone), consist of a shared alpha chain and a beta chain encoded by a separate gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Mu, Rt
Applications: ELISA, QFN
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Mu
Applications: WB
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ma, Hu, Mu
Applications: ChIP, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: AC
Publications for FSH beta Recombinant Protein Antigen (NBP2-57723PEP) (0)
There are no publications for FSH beta Recombinant Protein Antigen (NBP2-57723PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FSH beta Recombinant Protein Antigen (NBP2-57723PEP) (0)
There are no reviews for FSH beta Recombinant Protein Antigen (NBP2-57723PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for FSH beta Recombinant Protein Antigen (NBP2-57723PEP) (0)
Additional FSH beta Products
Research Areas for FSH beta Recombinant Protein Antigen (NBP2-57723PEP)
Find related products by research area.
|
Blogs on FSH beta