FRMD6 Antibody - BSA Free

Western Blot: FRMD6 Antibody [NBP3-05019] - Analysis of extracts of various cell lines, using FRMD6 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunocytochemistry/Immunofluorescence: FRMD6 Antibody [NBP3-05019] - Analysis of U2OS cells using FRMD6 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: FRMD6 Antibody [NBP3-05019] - Mouse heart using FRMD6 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Western Blot: FRMD6 Antibody [NBP3-05019] - Analysis of extracts of various cell lines, using FRMD6 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunocytochemistry/Immunofluorescence: FRMD6 Antibody [NBP3-05019] - Analysis of C6 cells using FRMD6 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: FRMD6 Antibody [NBP3-05019] - Rat heart using FRMD6 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: FRMD6 Antibody [NBP3-05019] - Human thyroid cancer using FRMD6 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FRMD6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FRMD6 Antibody - BSA Free (NBP3-05019) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 82-183 of human FRMD6 (NP_001253975.1). KEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENGRLISDRAARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAYF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FRMD6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000-1:4000
• Theoretical MW: 72 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for FRMD6 Antibody - BSA Free

• FERM domain containing 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: FRMD6