FRA-1/FOSL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FRA-1/FOSL1 Antibody [NBP2-57326] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FRA-1/FOSL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPE
Specificity
Specificity of human FRA-1/FOSL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOSL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FRA-1/FOSL1 Recombinant Protein Antigen (NBP2-57326PEP)

Reactivity Notes

Mouse 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FRA-1/FOSL1 Antibody

  • FOSL1
  • FOS-like antigen 1
  • FOS-like antigen-1
  • fos-related antigen 1
  • FRA
  • FRA1
  • FRA-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP2-57326
Species: Hu, Rt
Applications: ICC/IF

Publications for FRA-1/FOSL1 Antibody (NBP2-57326) (0)

There are no publications for FRA-1/FOSL1 Antibody (NBP2-57326).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FRA-1/FOSL1 Antibody (NBP2-57326) (0)

There are no reviews for FRA-1/FOSL1 Antibody (NBP2-57326). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FRA-1/FOSL1 Antibody (NBP2-57326) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FRA-1/FOSL1 Products

Bioinformatics Tool for FRA-1/FOSL1 Antibody (NBP2-57326)

Discover related pathways, diseases and genes to FRA-1/FOSL1 Antibody (NBP2-57326). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FRA-1/FOSL1 Antibody (NBP2-57326)

Discover more about diseases related to FRA-1/FOSL1 Antibody (NBP2-57326).
 

Pathways for FRA-1/FOSL1 Antibody (NBP2-57326)

View related products by pathway.

PTMs for FRA-1/FOSL1 Antibody (NBP2-57326)

Learn more about PTMs related to FRA-1/FOSL1 Antibody (NBP2-57326).
 

Research Areas for FRA-1/FOSL1 Antibody (NBP2-57326)

Find related products by research area.

Blogs on FRA-1/FOSL1

There are no specific blogs for FRA-1/FOSL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FRA-1/FOSL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOSL1