FoxP4 Antibody (3B12) - Azide and BSA Free

Western Blot: FoxP4 Antibody (3B12) [H00116113-M01] - Analysis of FOXP4 expression in transfected 293T cell line by FOXP4 monoclonal antibody (M01), clone 3B12.Lane 1: FOXP4 transfected lysate(73.2 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clone: 3B12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FoxP4 Antibody (3B12) - Azide and BSA Free Summary

• Immunogen: FOXP4 (NP_001012426.1, 586 a.a. ~ 679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEEL
• Specificity: FOXP4 - forkhead box P4 (3B12)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FOXP4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. Has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxP4 Antibody (3B12) - Azide and BSA Free

• FKHLA
• FLJ40908
• FLJ44184
• fork head-related protein like A
• Fork head-related protein-like A
• forkhead box P4
• forkhead box protein P4
• FoxP4
• hFKHLA
• winged-helix repressor FOXP4

Background

This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. This gene may play a role in the development of tumors of the kidney and larynx. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FoxP4 Antibody (H00116113-M01)(1)

Publication using H00116113-M01

• Clovis YM, Enard W, Marinaro F et al. Convergent repression of Foxp2 3'UTR by miR-9 and miR-132 in embryonic mouse neocortex: implications for radial migration of neurons. Development. 2012-08-08 [PMID: 22874921]

Bioinformatics

• Gene Symbol: FOXP4
• Entrez:
  • 116113(Human)
• Uniprot:
  • NP_001012426(Human)