FOXO4 Antibody


Western Blot: FOXO4 Antibody [NBP2-58083] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: FOXO4 Antibody [NBP2-58083] - Staining of human cell line A-431 shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

FOXO4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG
Specificity of human FOXO4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FOXO4 Recombinant Protein Antigen (NBP2-58083PEP)

Reactivity Notes

Mouse 87%, Rat 85%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for FOXO4 Antibody

  • AFX
  • AFX1myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 7
  • Fork head domain transcription factor AFX1
  • forkhead box O4
  • forkhead box protein O4
  • MLLT7MGC120490
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
Species: Mu
Applications: WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF

Publications for FOXO4 Antibody (NBP2-58083) (0)

There are no publications for FOXO4 Antibody (NBP2-58083).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXO4 Antibody (NBP2-58083) (0)

There are no reviews for FOXO4 Antibody (NBP2-58083). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FOXO4 Antibody (NBP2-58083) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for FOXO4 Antibody (NBP2-58083)

Discover related pathways, diseases and genes to FOXO4 Antibody (NBP2-58083). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXO4 Antibody (NBP2-58083)

Discover more about diseases related to FOXO4 Antibody (NBP2-58083).

Pathways for FOXO4 Antibody (NBP2-58083)

View related products by pathway.

PTMs for FOXO4 Antibody (NBP2-58083)

Learn more about PTMs related to FOXO4 Antibody (NBP2-58083).

Research Areas for FOXO4 Antibody (NBP2-58083)

Find related products by research area.

Blogs on FOXO4.

The role of HIF-1 Alpha signaling in the retina under hypoxic conditions
Hypoxia inducible factor 1 (HIF-1) is a protein that plays an essential role in hypoxia, or low levels of cellular oxygen. HIF-1 is a heterodimeric protein that consists of a constitutively expressed beta subunit and oxygen related alpha subunit. ...  Read full blog post.

The Wise Old Fox: Forkhead Transcription Factors and Age-Related DAF-16 Studies
Orthologs are one of the classes of homolog genes. They occur in different species, but are linked by a common ancestral pathway. During evolution, they retain the same original function, irrespective of the species. Among the orthologs covered on our...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FOXO4 Antibody and receive a gift card or discount.


Gene Symbol FOXO4