FOXO3 Antibody (8B9X5)

Western Blot: FOXO3 Antibody (8B9X5) [NBP3-16801] - Western blot analysis of extracts of various cell lines, using FOXO3 Rabbit mAb (NBP3-16801) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Western Blot: FOXO3 Antibody (8B9X5) [NBP3-16801] - Western blot analysis of extracts of various cell lines, using FOXO3 Rabbit mAb (NBP3-16801) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

• Reactivity: Hu, Mu
• Applications: WB
• Clone: 8B9X5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

FOXO3 Antibody (8B9X5) Summary

• Description: Novus Biologicals Rabbit FOXO3 Antibody (8B9X5) (NBP3-16801) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 574-673 of human FOXO3 (NP_001446.1). SPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: FOXO3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FOXO3 Antibody (8B9X5)

• AF6q21 protein
• AF6q21
• DKFZp781A0677
• FKHRL1
• FKHRL1MGC31925
• FKHRL1P2
• forkhead box O3
• forkhead box protein O3
• forkhead homolog (rhabdomyosarcoma) like 1
• Forkhead in rhabdomyosarcoma-like 1
• forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1
• FOXO2
• FoxO3
• FOXO3A
• FOXO3Aforkhead box O3A
• MGC12739

Background

FOX3 probably functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of the FOXO3 gene with the MLL gene is associated with secondary acute leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXO3