Home » FoxM1 » FoxM1 Antibodies » FoxM1 Antibody

FoxM1 Antibody

 (2 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: FoxM1 Antibody [NBP1-84671] - Primary AML mononuclear cells were obtained from patients with newly diagnosed or relapsed AML. Mononuclear cells were supplemented by CD34 expansion supplement for 24 hours in the presence of drug or 0.1% DMSO. Cells were then harvested for Western blot. Treated cells were harvested and lysed using IP buffer. Protein concentration was determined. Isolated proteins were separated on SDS-PAGE and transferred to PVDF membrane. Immunoblotting was carried out with antibodies specific for FOXM1 and B-actin. This image was submitted via customer review.
Biological Strategies: Western Blot: FoxM1 Antibody [NBP1-84671] - Primary AML mononuclear cells were obtained from patients with newly diagnosed or relapsed AML. Mononuclear cells were supplemented by CD34 ...read more
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human uterine cervix shows moderate nuclear positivity in a subset of epidermal cells.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human rectum shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human testis shows moderate nuclear positivity in few cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
   

Biological Strategies

      

Order Details

100% Guarantee on every product

FoxM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL
Marker
Mitosis Marker
Specificity
Specificity of human FoxM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
FoxM1 Lysate (NBP2-66259)
Control Peptide
FoxM1 Protein (NBP1-84671PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-84671 in the following applications:
Publications
Read Publications using
NBP1-84671 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxM1 Antibody

  • FKHL16
  • FKHL16trident
  • forkhead box M1
  • forkhead box protein M1
  • Forkhead, drosophila, homolog-like 16
  • forkhead-like 16
  • Forkhead-related protein FKHL16
  • FoxM1
  • Hepatocyte nuclear factor 3 forkhead homolog 11
  • HFH-11
  • HFH11FOXM1B
  • HFH-11M-phase phosphoprotein 2
  • HNF-3
  • HNF-3/fork-head homolog 11
  • INS-1
  • MPHOSPH2
  • MPP-2
  • MPP2MPM-2 reactive phosphoprotein 2
  • PIG29
  • TGT3
  • Transcription factor Trident
  • Trident
  • WIN
  • Winged-helix factor from INS-1 cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, Jurkat human acute T cell leukemia cell line, and K562 human chronic myelogenous leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for HNF‑3 beta /FoxA2 at approximately 48 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Mouse splenocytes were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. HNF‑3 beta /FoxA2/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The E-RABP promoter was detected by standard PCR.
HNF‑3 beta /FoxA2 was detected in immersion fixed endoderm differentiated BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(30 Publications)
Species: Hu
Applications: WB, IHC, ChIP, ICC
Cyclin B1 Antibody
(CCNB1/1098)
NBP2-44687
Immunohistochemistry-Paraffin: Cyclin B1 Antibody (CCNB1/1098) [NBP2-44687] - Human Testicular Carcinoma stained with Cyclin B1 Monoclonal Antibody (CCNB1/1098)
Immunohistochemistry-Paraffin: Cyclin B1 Antibody (CCNB1/1098) [NBP2-44687] - Human Endometrial Carcinoma stained with Cyclin B1 Monoclonal Antibody (CCNB1/1098)
Immunohistochemistry-Paraffin: Cyclin B1 Antibody (CCNB1/1098) [NBP2-44687] - Human Ovarian Carcinoma stained with Cyclin B1 Monoclonal Antibody (CCNB1/1098)
(1 Review)
Species: Hu, Mu
Applications: Flow, IHC-P, IF
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(13 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
HNF-3 alpha/FoxA1
Antibody (3B11NB)
NBP2-45269
Western Blot: HNF-3 alpha/FoxA1 Antibody (3B11NB) [NBP2-45269] - Whole cell protein from PC3 (1) and MCF7 (2) was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 4 ug/ml anti-hFOXA1 (3B11NB) in 1% milk and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: HNF-3 alpha/FoxA1 Antibody (3B11NB) [NBP2-45269] - FOXA1 (3B11NB) antibody was tested in HepG2 cells at a 1:25 dilution against DyLight 488 (Green) using a 40X objective. Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively
Immunohistochemistry-Paraffin: HNF-3 alpha/FoxA1 Antibody (3B11NB) [NBP2-45269] - Analysis of FOXA1 (3B11NB) in human prostate.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
IFI27 Antibody
NBP1-84745
Immunohistochemistry-Paraffin: IFI27 Antibody [NBP1-84745] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
TMED7 Antibody
NBP1-90949
Western Blot: TMED7 Antibody [NBP1-90949] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: TMED7 Antibody [NBP1-90949] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Dynactin 6 Antibody
NBP1-80616
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Dynactin 6 Antibody [NBP1-80616] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
SSSCA1 Antibody
NBP2-13387
Western Blot: SSSCA1 Antibody [NBP2-13387] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: SSSCA1 Antibody [NBP2-13387] - Staining of human cell line U-251 MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: SSSCA1 Antibody [NBP2-13387] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
26S proteasome
subunit 9 Antibody
NBP2-47560
Western Blot: 26S proteasome subunit 9 Antibody [NBP2-47560] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line MCF-7
Immunocytochemistry/Immunofluorescence: 26S proteasome subunit 9 Antibody [NBP2-47560] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47560] - Staining of human liver.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(19 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
p27/Kip1 [p
Thr157] Antibody
AF1555
Western blot shows lysates of MCF-7 human breast cancer cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF-I (Catalog # 291‑G1) for 20 minutes. PVDF membrane was probed with 0.5 µg/mL Human Phospho-p27/Kip1 (T157) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1555) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-p27/Kip1 (T157) was detected at approximately 27 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for 1 hour. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(11 Publications)
Species: Hu
Applications: WB
PLK1 Antibody
(13E8)
NB100-74502
Western Blot: PLK1 Antibody (13E8) [NB100-74502] - Proteins were transferred to a PVDF membrane and blocked with 5% Milk/TBST for at least 1 hour. Membranes were probed with PLK1 mouse monoclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform. Membranes were washed in TBS-0.1%Tween 20 and probed with a goat anti-mouse-HRP secondary antibody at a dilution of 1:20,000 for at least one hour. Membranes were washed and chemiluminescent detection performed.
Immunocytochemistry/Immunofluorescence: PLK1 Antibody (13E8) [NB100-74502] - PLK1 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) in WiDr colon carcinoma cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing PLK1 at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: PLK1 Antibody (13E8) [NB100-74502] - Both normal and cancer biopsies of deparaffinized human Colon tissue.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - Analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - Analysis of FFPE mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Cyclin D1 Antibody
NBP2-24695
Western Blot: Cyclin D1 Antibody [NBP2-24695] - Analysis of 1) mouse C2C12 and 2) mouse NIH 3T3 lysate using Cyclin D1 antibody at 5 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Cyclin D1 Antibody [NBP2-24695] - Formalin-fixed, paraffin-embedded human small intestine stained with Cyclin D1 antibody at 10 ug/ml.
(2 Publications)
Species: Hu
Applications: WB, IHC-P
PSD93 Antibody
NBP1-88088
Immunohistochemistry-Paraffin: PSD93 Antibody [NBP1-88088] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: PSD93 Antibody [NBP1-88088] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: PSD93 Antibody [NBP1-88088] - Staining of human cerebral cortex shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GLB1.
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for FoxM1 Antibody (NBP1-84671)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species

Review for FoxM1 Antibody (NBP1-84671) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-84671:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot FoxM1 NBP1-84671
Enlarge
reviewed by:
Anonymous
 WB Human 02/14/2018
View

Summary

ApplicationWestern Blot
Sample TestedAML mononuclear cells
SpeciesHuman
LotN/A

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxM1 Antibody (NBP1-84671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

FoxM1 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FoxM1 Antibody (NBP1-84671)

Discover related pathways, diseases and genes to FoxM1 Antibody (NBP1-84671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxM1 Antibody (NBP1-84671)

Discover more about diseases related to FoxM1 Antibody (NBP1-84671).
 

Pathways for FoxM1 Antibody (NBP1-84671)

View related products by pathway.

PTMs for FoxM1 Antibody (NBP1-84671)

Learn more about PTMs related to FoxM1 Antibody (NBP1-84671).
 

Research Areas for FoxM1 Antibody (NBP1-84671)

Find related products by research area.

Blogs on FoxM1

There are no specific blogs for FoxM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
Western Blot FoxM1 NBP1-84671
Enlarge
 Anonymous
02/14/2018
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol FOXM1