Home » FoxM1 » FoxM1 Antibodies » FoxM1 Antibody

FoxM1 Antibody

 (2 Publications)
 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: FoxM1 Antibody [NBP1-84671] - Primary AML mononuclear cells were obtained from patients with newly diagnosed or relapsed AML. Mononuclear cells were supplemented by CD34 expansion supplement for 24 hours in the presence of drug or 0.1% DMSO. Cells were then harvested for Western blot. Treated cells were harvested and lysed using IP buffer. Protein concentration was determined. Isolated proteins were separated on SDS-PAGE and transferred to PVDF membrane. Immunoblotting was carried out with antibodies specific for FOXM1 and B-actin. This image was submitted via customer review.
Biological Strategies: Western Blot: FoxM1 Antibody [NBP1-84671] - Primary AML mononuclear cells were obtained from patients with newly diagnosed or relapsed AML. Mononuclear cells were supplemented by CD34 ...read more
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human uterine cervix shows moderate nuclear positivity in a subset of epidermal cells.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human rectum shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human testis shows moderate nuclear positivity in few cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
   

Biological Strategies

      

Order Details

100% Guarantee on every product

FoxM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL
Marker
Mitosis Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 30089730). For IHC-Paraffin, HIER pH 6 retrieval is recommended. FoxM1 antibody validated for WB from a verified customer review.
Control Peptide
FoxM1 Protein (NBP1-84671PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-84671 in the following applications:
Publications
Read Publications using
NBP1-84671 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxM1 Antibody

  • FKHL16
  • FKHL16trident
  • forkhead box M1
  • forkhead box protein M1
  • Forkhead, drosophila, homolog-like 16
  • forkhead-like 16
  • Forkhead-related protein FKHL16
  • FoxM1
  • Hepatocyte nuclear factor 3 forkhead homolog 11
  • HFH-11
  • HFH11FOXM1B
  • HFH-11M-phase phosphoprotein 2
  • HNF-3
  • HNF-3/fork-head homolog 11
  • INS-1
  • MPHOSPH2
  • MPP-2
  • MPP2MPM-2 reactive phosphoprotein 2
  • PIG29
  • TGT3
  • Transcription factor Trident
  • Trident
  • WIN
  • Winged-helix factor from INS-1 cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(11 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Mouse splenocytes were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. HNF‑3 beta /FoxA2/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The E-RABP promoter was detected by standard PCR.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, Jurkat human acute T cell leukemia cell line, and K562 human chronic myelogenous leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for HNF‑3 beta /FoxA2 at approximately 48 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
HNF‑3 beta /FoxA2 was detected in immersion fixed endoderm differentiated BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human HNF‑3 beta /FoxA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2400) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(50 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
Cyclin B1 Antibody
[Unconjugated]
AF6000
Cyclin B1 was detected in immersion fixed paraffin-embedded sections of human lymphoma using Goat Anti-Human/Mouse Cyclin B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6000) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counter­stained with hematoxylin (blue). Specific staining was localized to cytoplasm in lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of U2OS human osteosarcoma cell line, K562 human chronic myelogenous leukemia cell line, HeLa human cervical epithelial carcinoma cell line, and Jurkat human acute T cell leukemia cell line. PVDF Membrane was probed with 0.2 µg/mL of Goat Anti-Human/Mouse Cyclin B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6000) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Cyclin B1 at approximately 62 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for Cyclin B1 at approximately 67 kDa (as indicated) using 2 µg/mL of Goat Anti-Human/Mouse Cyclin B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6000) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(3 Publications)
Species: Hu, Mu
Applications: IHC, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HNF-3 alpha/FoxA1
Antibody (3B11NB)
NBP2-45269
Flow Cytometry: HNF-3 alpha/FoxA1 Antibody (3B11NB) [NBP2-45269] - Analysis using the Azide Free version of NBP2-45269. Staining of HepG2 cells (1 x 10^6 cells/ml) with FOXA1 antibody, clone 3B11NB (orange), shown with the negative control (blue).
Flow Cytometry: HNF-3 alpha/FoxA1 Antibody (3B11NB) [NBP2-45269] - Analysis using the Azide Free version of NBP2-45269. Staining of LnCAP cells (1 x 10^6 cells/ml) with FOXA1 antibody, clone 3B11NB (orange), shown with the negative control (blue).
Western Blot: HNF-3 alpha/FoxA1 Antibody (3B11NB) [NBP2-45269] - Analysis of FOXA1 (3B11NB) in partial recombinant FOXA1 protein and PC3 lysate, respectivetly.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IFI27 Antibody
NBP1-84745
Immunohistochemistry-Paraffin: IFI27 Antibody [NBP1-84745] - Staining of human stomach shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: IFI27 Antibody [NBP1-84745] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: IFI27 Antibody [NBP1-84745] - Staining of human prostate shows no positivity in glandular cells as expected.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
TMED7 Antibody
NBP1-90949
Immunohistochemistry-Paraffin: TMED7 Antibody [NBP1-90949] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western Blot: TMED7 Antibody [NBP1-90949] - Analysis in human cell line CAPAN-2.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Dynactin 6 Antibody
NBP1-80616
Immunohistochemistry-Paraffin: Dynactin 6 Antibody [NBP1-80616] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SSSCA1 Antibody
(OTI2F5) - Azide and ...
NBP2-74359
Western Blot: SSSCA1 Antibody (OTI2F5) - Azide and BSA Free [NBP2-74359] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SSSCA1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SSSCA1.
Flow Cytometry: SSSCA1 Antibody (OTI2F5) - Azide and BSA Free [NBP2-74359] - Analysis of Hela cells, using anti-SSSCA1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: SSSCA1 Antibody (OTI2F5) - Azide and BSA Free [NBP2-74359] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostaining by anti-SSSCA1 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
26S proteasome
subunit 9 Antibody
NBP2-47561
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney, liver, skin and testis using Anti-PSMD9 antibody NBP2-47561 (A) shows similar protein distribution across tissues to independent antibody NBP2-47560(B).
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney using Anti-PSMD9 antibody.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human liver using Anti-PSMD9 antibody.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(25 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
p27/Kip1 [p
Thr157] Antibody
AF1555
Western blot shows lysates of MCF-7 human breast cancer cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF-I (Catalog # 291‑G1) for 20 minutes. PVDF membrane was probed with 0.5 µg/mL Human Phospho-p27/Kip1 (T157) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1555) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-p27/Kip1 (T157) was detected at approximately 27 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for 1 hour. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(12 Publications)
Species: Hu
Applications: WB
PLK1 Antibody
(OTI1D4)
NBP1-48291
Western Blot: PLK1 Antibody (OTI1D4) [NBP1-48291] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PLK1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PLK1.
Immunohistochemistry-Paraffin: PLK1 Antibody (OTI1D4) [NBP1-48291] - Staining of paraffin-embedded Adenocarcinoma of Human colon tissue using anti-PLK1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PLK1 Antibody (OTI1D4) [NBP1-48291] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-PLK1 mouse monoclonal antibody.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
p19ARF/CDKN2A
Antibody
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(45 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot: Cyclin D1 Antibody (SPM587) [NBP2-32840] - HELLS expression and protein levels are modulated with YAP1/TEAD inhibition downstream of SHH signaling. Western blot showing protein levels of HELLS, cleaved caspase 3 (CC3), and Cyclin D1 in verteporfin treated CGNPs. Blot is representative of three replicates. Full-length blots are presented in Supplementary Fig. S4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-50088-1), licensed under a CC-BY licence.
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on Jurkat cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on MCF-7 cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
(1 Review)
(7 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PSD93 Antibody
(S18-30)
NBP2-12912
Immunocytochemistry/Immunofluorescence: PSD93 Antibody (S18-30) [NBP2-12912] - Tissue: SK-N-BE Cells (Human Neuroblastoma cells). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Chapsyn-110 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Membrane, Cell Junction, Synapse, Postsynaptic Cell Membrane. Magnification: 60X.
Western Blot: PSD93 Antibody (S18-30) [NBP2-12912] - analysis of Rat brain membrane lysate showing detection of Chapsyn-110 protein using Mouse Anti-Chapsyn-110 Monoclonal Antibody, Clone S18-30 . Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Chapsyn-110 Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Carcinoma of Human thyroid tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: IHC, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB

Publications for FoxM1 Antibody (NBP1-84671)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for FoxM1 Antibody (NBP1-84671) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP1-84671:
Filter by Applications
WB
(2)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot FoxM1 NBP1-84671
Enlarge 		5
reviewed by:
Verified Customer
 WB Human 01/08/2019
View

Summary

ApplicationWestern Blot
Sample Tested3 human pancreas cancer cell lines
SpeciesHuman
LotC115795
Western Blot FoxM1 NBP1-84671
Enlarge 		4
reviewed by:
Verified Customer
 WB Human 02/14/2018
View

Summary

ApplicationWestern Blot
Sample TestedAML mononuclear cells
SpeciesHuman
LotN/A

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxM1 Antibody (NBP1-84671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional FoxM1 Products

Bioinformatics Tool for FoxM1 Antibody (NBP1-84671)

Discover related pathways, diseases and genes to FoxM1 Antibody (NBP1-84671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxM1 Antibody (NBP1-84671)

Discover more about diseases related to FoxM1 Antibody (NBP1-84671).
 

Pathways for FoxM1 Antibody (NBP1-84671)

View related products by pathway.

PTMs for FoxM1 Antibody (NBP1-84671)

Learn more about PTMs related to FoxM1 Antibody (NBP1-84671).
 

Research Areas for FoxM1 Antibody (NBP1-84671)

Find related products by research area.

Blogs on FoxM1

There are no specific blogs for FoxM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0
Western Blot FoxM1 NBP1-84671
Enlarge
 Verified Customer
01/08/2019
Application: WB
Species: Human
read this review
Western Blot FoxM1 NBP1-84671
Enlarge
 Verified Customer
02/14/2018
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol FOXM1