Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL |
Marker | Mitosis Marker |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | FOXM1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | WB reported in scientific literature (PMID: 30089730). For IHC-Paraffin, HIER pH 6 retrieval is recommended. FoxM1 antibody validated for WB from a verified customer review. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-84671 | Applications | Species |
---|---|---|
Khan I, Halasi M, Patel A et al. FOXM1 contributes to treatment failure in acute myeloid leukemia JCI Insight Aug 9 2018 [PMID: 30089730] (WB, Human) | WB | Human |
Halasi M, Hitchinson B, Shah BN et al. Honokiol is a FOXM1 antagonist Cell Death Dis 2018 Jan 24 [PMID: 29367668] (WB, Human) | WB | Human |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Feng Li |
WB | Human | 01/08/2019 |
Summary
|
||||||||
![]() Enlarge |
reviewed by:
Lisa Ikariyama |
WB | Human | 02/14/2018 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for FoxM1 Antibody (NBP1-84671)Discover more about diseases related to FoxM1 Antibody (NBP1-84671).
| Pathways for FoxM1 Antibody (NBP1-84671)View related products by pathway.
|
PTMs for FoxM1 Antibody (NBP1-84671)Learn more about PTMs related to FoxM1 Antibody (NBP1-84671).
| Research Areas for FoxM1 Antibody (NBP1-84671)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Feng Li 01/08/2019 |
||
Application: | WB | |
Species: | Human |
Lisa Ikariyama 02/14/2018 |
||
Application: | WB | |
Species: | Human |
Gene Symbol | FOXM1 |