| Reactivity | HuSpecies Glossary |
| Applications | IHC, ChIP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL |
| Marker | Mitosis Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FOXM1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-84671 | Applications | Species |
|---|---|---|
| Khan I, Halasi M, Patel A et al. FOXM1 contributes to treatment failure in acute myeloid leukemia JCI Insight 2018-08-09 [PMID: 30089730] (WB, Human) | WB | Human |
| Halasi M, Hitchinson B, Shah BN et al. Honokiol is a FOXM1 antagonist Cell Death Dis 2018-01-24 [PMID: 29367668] (WB, Human) | WB | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 01/08/2019 |
Summary
|
||||||||
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 02/14/2018 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for FoxM1 Antibody (NBP1-84671)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 01/08/2019 |
||
| Application: | WB | |
| Species: | Human |
| Verified Customer 02/14/2018 |
||
| Application: | WB | |
| Species: | Human |
| Gene Symbol | FOXM1 |