FoxM1 Antibody

Images

 
Biological Strategies: Western Blot: FoxM1 Antibody [NBP1-84671] - Primary AML mononuclear cells were obtained from patients with newly diagnosed or relapsed AML. Mononuclear cells were supplemented by CD34 ...read more
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human uterine cervix shows moderate nuclear positivity in a subset of epidermal cells.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human rectum shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human testis shows moderate nuclear positivity in few cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
   

Biological Strategies

     

Order Details

FoxM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL
Marker
Mitosis Marker
Specificity
Specificity of human FoxM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
FoxM1 Lysate (NBP2-66259)
Control Peptide
FoxM1 Protein (NBP1-84671PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-84671 in the following applications:

Publications
Read Publications using
NBP1-84671 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxM1 Antibody

  • FKHL16
  • FKHL16trident
  • forkhead box M1
  • forkhead box protein M1
  • Forkhead, drosophila, homolog-like 16
  • forkhead-like 16
  • Forkhead-related protein FKHL16
  • FoxM1
  • Hepatocyte nuclear factor 3 forkhead homolog 11
  • HFH-11
  • HFH11FOXM1B
  • HFH-11M-phase phosphoprotein 2
  • HNF-3
  • HNF-3/fork-head homolog 11
  • INS-1
  • MPHOSPH2
  • MPP-2
  • MPP2MPM-2 reactive phosphoprotein 2
  • PIG29
  • TGT3
  • Transcription factor Trident
  • Trident
  • WIN
  • Winged-helix factor from INS-1 cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2400
Species: Hu
Applications: WB, ChIP, ICC
AF6000
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-90949
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47561
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF1555
Species: Hu
Applications: WB
NB100-74502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NBP1-88088
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for FoxM1 Antibody (NBP1-84671)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species

Review for FoxM1 Antibody (NBP1-84671) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-84671:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot FoxM1 NBP1-84671
Enlarge
reviewed by:
Anonymous
WB Human 02/14/2018
View

Summary

ApplicationWestern Blot
Sample TestedAML mononuclear cells
SpeciesHuman
LotN/A

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxM1 Antibody (NBP1-84671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FoxM1 Antibody (NBP1-84671)

Discover related pathways, diseases and genes to FoxM1 Antibody (NBP1-84671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxM1 Antibody (NBP1-84671)

Discover more about diseases related to FoxM1 Antibody (NBP1-84671).
 

Pathways for FoxM1 Antibody (NBP1-84671)

View related products by pathway.

PTMs for FoxM1 Antibody (NBP1-84671)

Learn more about PTMs related to FoxM1 Antibody (NBP1-84671).
 

Research Areas for FoxM1 Antibody (NBP1-84671)

Find related products by research area.

Blogs on FoxM1

There are no specific blogs for FoxM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
02/14/2018
Application: WB
Species: Human

Bioinformatics

Gene Symbol FOXM1