FOXL1 Antibody (1C3)

Images

 
Immunohistochemistry-Paraffin: FOXL1 Antibody (1C3) [H00002300-M04] - Analysis of monoclonal antibody to FOXL1 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
1C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FOXL1 Antibody (1C3) Summary

Immunogen
FOXL1 (NP_005241, 132 a.a. ~ 240 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAARTGDGP
Specificity
FOXL1 (1C3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA and WB. It has been used for IHC-P.
Publications
Read Publication using H00002300-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FOXL1 Antibody (1C3)

  • FKH6forkhead box protein L1
  • FKHL11forkhead-like 11
  • forkhead box L1
  • Forkhead-related protein FKHL11
  • Forkhead-related transcription factor 7
  • FREAC7FREAC-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6989
Species: Mu
Applications: IHC
1845-SH/CF
Species: Hu
Applications: BA
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, IHC, IHC-P, KD, WB
AF4798
Species: Hu, Mu
Applications: WB
AF1705
Species: Mu
Applications: IHC, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
1726-JG
Species: Hu
Applications: BA
NBP1-82991
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
5396-SF
Species: Hu
Applications: BA
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-75713
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-84671
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP2-45736
Species: Hu
Applications: IHC, IHC-P, WB

Publications for FOXL1 Antibody (H00002300-M04)(1)


Reviews for FOXL1 Antibody (H00002300-M04) (0)

There are no reviews for FOXL1 Antibody (H00002300-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXL1 Antibody (H00002300-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOXL1 Products

Bioinformatics Tool for FOXL1 Antibody (H00002300-M04)

Discover related pathways, diseases and genes to FOXL1 Antibody (H00002300-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXL1 Antibody (H00002300-M04)

Discover more about diseases related to FOXL1 Antibody (H00002300-M04).
 

Pathways for FOXL1 Antibody (H00002300-M04)

View related products by pathway.

PTMs for FOXL1 Antibody (H00002300-M04)

Learn more about PTMs related to FOXL1 Antibody (H00002300-M04).

Blogs on FOXL1

There are no specific blogs for FOXL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOXL1 Antibody (1C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXL1
Entrez
OMIM
Uniprot