FoxK1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FoxK1 Antibody [NBP1-83110] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.

Immunohistochemistry-Paraffin: FoxK1 Antibody [NBP1-83110] - Staining in human cerebral cortex and liver tissues using NBP1-83110 antibody. Corresponding FOXK1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FoxK1 Antibody [NBP1-83110] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: FoxK1 Antibody [NBP1-83110] - Staining of human cerebral cortex, liver, lymphoid tissues and testis using Anti-FOXK1 antibody NBP1-83110 (A) shows similar protein distribution across tissues to independent antibody NBP1-83109 (B).

Immunohistochemistry-Paraffin: FoxK1 Antibody [NBP1-83110] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: FoxK1 Antibody [NBP1-83110] - Staining of human lymph node shows moderate to strong nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: FoxK1 Antibody [NBP1-83110] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FoxK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FoxK1 Antibody - BSA Free (NBP1-83110) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSLVAKPVAYMPASIVTSQQPAGHAIHVVQQAPTVTMVRVVTTSANSANGYILTSQGAAGGSHDAAGAAVLDLGSEARGLEEKPTIAFATIPAAGGVIQTVA
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FoxK1 Protein (NBP1-83110PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FoxK1 Antibody - BSA Free

• FLJ14977
• forkhead box K1
• forkhead box protein K1
• FoxK1
• FOXK1L
• IMAGE:5164497
• MNF
• Myocyte nuclear factor

Background

Forkhead box protein K1 (FoxK1) is a member of the human Forkhead-box (FOX) family of proteins. The Forkhead-box domain is a highly conserved DNA binding domain of about 100 amino acids found in proteins that function as transcriptional regulators. FoxK1 also bears an FHA (forkhead-associated) domain, a putative nuclear signaling domain that binds phospho-peptides. FoxK1 has been shown to play a role in the regulation of myogeneic progenitor cells and skeletal muscle regeneration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXK1