FOXG1 Antibody


Western Blot: FOXG1 Antibody [NBP2-86636] - WB Suggested Anti-FOXG1B Antibody Titration: 1.25ug/ml. ELISA Titer: 1:312500. Positive Control: Transfected 293T

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FOXG1 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of human FOXG1. Peptide sequence: STSMSARATSSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQ The peptide sequence for this immunogen was taken from within the described region.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Protein A purified

Alternate Names for FOXG1 Antibody

  • BF-1
  • BF1HBF-2
  • BF2
  • BF-2
  • Brain factor 1
  • Brain factor 2
  • FHKL3
  • FKHL1forkhead-like 1
  • FKHL2
  • FKHL3
  • FKHL4
  • forkhead box G1
  • forkhead box G1A
  • forkhead box G1B
  • forkhead box G1C
  • Forkhead box protein G1A
  • Forkhead box protein G1B
  • Forkhead box protein G1C
  • forkhead-like 3
  • forkhead-like 4
  • Forkhead-related protein FKHL1
  • Forkhead-related protein FKHL2
  • Forkhead-related protein FKHL3
  • FOXG1A
  • FOXG1Bforkhead-like 2
  • FOXG1C
  • HBF-1
  • hBF-2
  • HBF-3
  • HFK1HBF-G2
  • HFK2HBF2
  • HFK3KHL2
  • oncogene QIN
  • QINFKH2forkhead box protein G1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB

Publications for FOXG1 Antibody (NBP2-86636) (0)

There are no publications for FOXG1 Antibody (NBP2-86636).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXG1 Antibody (NBP2-86636) (0)

There are no reviews for FOXG1 Antibody (NBP2-86636). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXG1 Antibody (NBP2-86636) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FOXG1 Products

Bioinformatics Tool for FOXG1 Antibody (NBP2-86636)

Discover related pathways, diseases and genes to FOXG1 Antibody (NBP2-86636). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXG1 Antibody (NBP2-86636)

Discover more about diseases related to FOXG1 Antibody (NBP2-86636).

Pathways for FOXG1 Antibody (NBP2-86636)

View related products by pathway.

PTMs for FOXG1 Antibody (NBP2-86636)

Learn more about PTMs related to FOXG1 Antibody (NBP2-86636).

Research Areas for FOXG1 Antibody (NBP2-86636)

Find related products by research area.

Blogs on FOXG1.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FOXG1 Antibody and receive a gift card or discount.


Gene Symbol FOXG1