FoxC1 Partial Protein

Images

 
There are currently no images for FoxC1 Partial Recombinant Protein (H00002296-Q01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

FoxC1 Partial Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-99 of Human FOXC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRR

Protein/Peptide Type
Partial Protein
Gene
FOXC1

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxC1 Partial Protein

  • ARA
  • FKHL7
  • FKHL7RIEG3
  • forkhead box C1
  • forkhead box protein C1
  • forkhead, drosophila, homolog-like 7
  • forkhead/winged helix-like transcription factor 7
  • forkhead-related activator 3
  • Forkhead-related protein FKHL7
  • Forkhead-related transcription factor 3
  • FoxC1
  • FREAC3
  • FREAC-3
  • FREAC3IRID1
  • IGDA
  • IHG1
  • IRID1
  • myeloid factor-delta
  • RIEG3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-46538
Species: Hu
Applications: WB, IHC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00002296-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for FoxC1 Partial Recombinant Protein (H00002296-Q01) (0)

There are no publications for FoxC1 Partial Recombinant Protein (H00002296-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxC1 Partial Recombinant Protein (H00002296-Q01) (0)

There are no reviews for FoxC1 Partial Recombinant Protein (H00002296-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxC1 Partial Recombinant Protein (H00002296-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FoxC1 Products

Bioinformatics Tool for FoxC1 Partial Recombinant Protein (H00002296-Q01)

Discover related pathways, diseases and genes to FoxC1 Partial Recombinant Protein (H00002296-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxC1 Partial Recombinant Protein (H00002296-Q01)

Discover more about diseases related to FoxC1 Partial Recombinant Protein (H00002296-Q01).
 

Pathways for FoxC1 Partial Recombinant Protein (H00002296-Q01)

View related products by pathway.

PTMs for FoxC1 Partial Recombinant Protein (H00002296-Q01)

Learn more about PTMs related to FoxC1 Partial Recombinant Protein (H00002296-Q01).
 

Research Areas for FoxC1 Partial Recombinant Protein (H00002296-Q01)

Find related products by research area.

Blogs on FoxC1

There are no specific blogs for FoxC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FoxC1 Antibody
NB100-1268

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxC1 Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXC1
Entrez