FOLR1 Antibody


Western Blot: FOLR1 Antibody [NBP1-69363] - PANC1 Whole Cell Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1 ug/ml Peptide Concentration: 5 ug/ml lysate Quantity: more
Immunohistochemistry: FOLR1 Antibody [NBP1-69363] - Human Adult liver Observed Staining: Cytoplasmic,Membrane in bile ducts not in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey more
Western Blot: FOLR1 Antibody [NBP1-69363] - This Anti-FOLR1 antibody was used in Western Blot of PANC1 tissue lysate at a concentration of 1ug/ml.
Western Blot: FOLR1 Antibody [NBP1-69363] - Sample Tissue: PANC1 Whole Cell, Lane A: Primary Antibody, Lane B:Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, more
Western Blot: FOLR1 Antibody [NBP1-69363] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry-Paraffin: FOLR1 Antibody [NBP1-69363] - Folate Binding Protein Antibody [NBP1-69363] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Membrane and more

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

FOLR1 Antibody Summary

Synthetic peptides corresponding to FOLR1(folate receptor 1 (adult)) The peptide sequence was selected from the middle region of FOLR1. Peptide sequence HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
FOLR1 Lysate (NBP2-64828)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FOLR1 Antibody

  • Adult folate-binding protein
  • FBP
  • folate binding protein
  • folate receptor 1 (adult)
  • Folate receptor 1
  • folate receptor alpha
  • Folate receptor, adult
  • Folbp1
  • FOLR
  • FOLR1
  • FR-alpha
  • KB cells FBP
  • MOv18
  • Ovarian tumor-associated antigen MOv18


The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anc


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Rt
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FOLR1 Antibody (NBP1-69363) (0)

There are no publications for FOLR1 Antibody (NBP1-69363).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOLR1 Antibody (NBP1-69363) (0)

There are no reviews for FOLR1 Antibody (NBP1-69363). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FOLR1 Antibody (NBP1-69363) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional FOLR1 Products

Bioinformatics Tool for FOLR1 Antibody (NBP1-69363)

Discover related pathways, diseases and genes to FOLR1 Antibody (NBP1-69363). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOLR1 Antibody (NBP1-69363)

Discover more about diseases related to FOLR1 Antibody (NBP1-69363).

Pathways for FOLR1 Antibody (NBP1-69363)

View related products by pathway.

PTMs for FOLR1 Antibody (NBP1-69363)

Learn more about PTMs related to FOLR1 Antibody (NBP1-69363).

Research Areas for FOLR1 Antibody (NBP1-69363)

Find related products by research area.

Blogs on FOLR1

There are no specific blogs for FOLR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FOLR1 Antibody and receive a gift card or discount.


Gene Symbol FOLR1