FNDC3A Antibody

Images

 
Immunohistochemistry: FNDC3A Antibody [NBP1-88810] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FNDC3A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FNDC3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FNDC3A Protein (NBP1-88810PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FNDC3A Antibody

  • bA203I16.1
  • bA203I16.5
  • fibronectin type III domain containing 3
  • fibronectin type III domain containing 3A
  • fibronectin type-III domain-containing protein 3A
  • FNDC3
  • HUGO
  • Human gene expressed in odontoblasts
  • KIAA0970FLJ31509

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2420
Species: Hu
Applications: WB, IHC
NBP1-88641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-46466
Species: Hu
Applications: IHC
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB6798
Species: Hu
Applications: WB, ICC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1749
Species: Rt
Applications: WB, IHC
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91920
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33664
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-88810
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for FNDC3A Antibody (NBP1-88810) (0)

There are no publications for FNDC3A Antibody (NBP1-88810).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FNDC3A Antibody (NBP1-88810) (0)

There are no reviews for FNDC3A Antibody (NBP1-88810). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FNDC3A Antibody (NBP1-88810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FNDC3A Products

Bioinformatics Tool for FNDC3A Antibody (NBP1-88810)

Discover related pathways, diseases and genes to FNDC3A Antibody (NBP1-88810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FNDC3A Antibody (NBP1-88810)

Discover more about diseases related to FNDC3A Antibody (NBP1-88810).
 

Pathways for FNDC3A Antibody (NBP1-88810)

View related products by pathway.

Blogs on FNDC3A

There are no specific blogs for FNDC3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FNDC3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FNDC3A