FMNL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FMNL2 Antibody [NBP1-83901] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: FMNL2 Antibody [NBP1-83901] - Staining of human lateral ventricle shows cytoplasmic positivity in neurons and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FMNL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FMNL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FMNL2 Protein (NBP1-83901PEP)
Publications
Read Publications using
NBP1-83901 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25963818).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FMNL2 Antibody

  • FHOD2
  • FLJ37546
  • formin homology 2 domain containing 2
  • Formin homology 2 domain-containing protein 2
  • formin-like 2
  • formin-like protein 2
  • KIAA1902

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88460
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24724
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB
NBP2-24536
Species: Hu, Mu
Applications: WB
NBP2-24623
Species: Hu, Mu, Rt, Bv, Ca, Eq
Applications: WB
NBP1-94174
Species: Hu
Applications: WB, IHC, IHC-P
NB600-230
Species: Hu
Applications: WB
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-83900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24615
Species: Hu
Applications: WB, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84718
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-93579
Species: Hu
Applications: IHC, IHC-P
NBP2-14021
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83901
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FMNL2 Antibody (NBP1-83901)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FMNL2 Antibody (NBP1-83901) (0)

There are no reviews for FMNL2 Antibody (NBP1-83901). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FMNL2 Antibody (NBP1-83901) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FMNL2 Products

Bioinformatics Tool for FMNL2 Antibody (NBP1-83901)

Discover related pathways, diseases and genes to FMNL2 Antibody (NBP1-83901). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FMNL2 Antibody (NBP1-83901)

Discover more about diseases related to FMNL2 Antibody (NBP1-83901).
 

Pathways for FMNL2 Antibody (NBP1-83901)

View related products by pathway.

PTMs for FMNL2 Antibody (NBP1-83901)

Learn more about PTMs related to FMNL2 Antibody (NBP1-83901).

Blogs on FMNL2

There are no specific blogs for FMNL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FMNL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FMNL2