FMNL2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FMNL2 Antibody [NBP1-83901] - Staining of human cell line U-251 MG shows localization to plasma membrane and cytosol.

Analysis in human cell lines SK-MEL-30 and U2OS using Anti-FMNL2 antibody. Corresponding FMNL2 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in glial cells.

Analysis in human cerebral cortex and liver tissues using NBP1-83901 antibody. Corresponding FMNL2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FMNL2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGP
• Predicted Species: Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FMNL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB, ICC/IF reported in scientific literature (PMID: 25963818). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FMNL2 Protein (NBP1-83901PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25963818).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FMNL2 Antibody - BSA Free

• FHOD2
• FLJ37546
• formin homology 2 domain containing 2
• Formin homology 2 domain-containing protein 2
• formin-like 2
• formin-like protein 2
• KIAA1902

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FMNL2 Antibody (NBP1-83901)(2)

Publications using NBP1-83901

• Grikscheit K, Frank T, Wang Y, Grosse R. Junctional actin assembly is mediated by Formin-like 2 downstream of Rac1. J Cell Biol 2015-05-11 [PMID: 25963818] (ICC/IF, WB, Human)
• Gardberg M, Talvinen K, Kaipio K et al. Characterization of Diaphanous-related formin FMNL2 in human tissues. BMC Cell Biol 2010-07-01 [PMID: 20633255]

Bioinformatics

• Gene Symbol: FMNL2